Citrus Sinensis ID: 023177


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL
ccccccccccEEEEEEccccHHHHHHHHcccccEEEcccHHHHHHHcccccccccccEEEEEccHHccccccHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEEEccccccccEEEEEEEEcccccHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEccccccccccEEccccccccccccEEEEcccHHHHHHHHHHHHHHccccccccccHHccc
ccHHccccccEEEEEEccccccHHHHHHHccccEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEcEcccccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHccccEEEEEEHHHHcccccccccEEEEEcccccHHHHEEEEccccccccccEEEEEEcHcHHHHHHHHHHHHHHHHHHccccHHHHc
MRALGDYLGVKVHAcvggtsvreDQRILQAGVHVVVGTPGRVFDMLRrqslrpdyikMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQvgvfsatmppeALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDwltdkmrsrdhtvsathgdmdqntRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVInydlptqpenylhrigrsgrfgrkgvainfvtrdderMLFDIQKFYNVVIEELpsnvadll
MRALGDYLGVKVHACVGGTSVREDQRILQAGvhvvvgtpgrvfDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALeitrkfmnkpvRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLaitqsvifvntrrkvdwltdkmrsrdhtvsathgdmdqntrDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYlhrigrsgrfgrkGVAINfvtrddermLFDIQKFYNVVIEELPSNVADLL
MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL
***LGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDK********************DIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEEL********
*RALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNV**LL
MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL
MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNV***L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
P35683414 Eukaryotic initiation fac yes no 1.0 0.690 0.972 1e-164
P41379413 Eukaryotic initiation fac N/A no 1.0 0.692 0.972 1e-164
Q40467413 Eukaryotic initiation fac N/A no 1.0 0.692 0.965 1e-163
P41376412 Eukaryotic initiation fac yes no 1.0 0.694 0.972 1e-163
P41381413 Eukaryotic initiation fac N/A no 1.0 0.692 0.961 1e-163
P41382413 Eukaryotic initiation fac N/A no 1.0 0.692 0.965 1e-163
Q6Z2Z4414 Eukaryotic initiation fac yes no 1.0 0.690 0.965 1e-163
Q40465413 Eukaryotic initiation fac N/A no 1.0 0.692 0.965 1e-163
Q40471413 Eukaryotic initiation fac N/A no 1.0 0.692 0.961 1e-162
P41377412 Eukaryotic initiation fac yes no 1.0 0.694 0.965 1e-162
>sp|P35683|IF4A1_ORYSJ Eukaryotic initiation factor 4A-1 OS=Oryza sativa subsp. japonica GN=Os06g0701100 PE=2 SV=2 Back     alignment and function desciption
 Score =  578 bits (1489), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 278/286 (97%), Positives = 284/286 (99%)

Query: 1   MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 60
           MRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRPDYIKMFV
Sbjct: 129 MRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 188

Query: 61  LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 120
           LDEADEMLSRGFKDQIYDIFQLLP+K+QVGVFSATMPPEALEITRKFMNKPVRILVKRDE
Sbjct: 189 LDEADEMLSRGFKDQIYDIFQLLPSKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 248

Query: 121 LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 180
           LTLEGIKQFYVNVEKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVS
Sbjct: 249 LTLEGIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVS 308

Query: 181 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 240
           ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI
Sbjct: 309 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 368

Query: 241 GRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286
           GRSGRFGRKGVAINFVTRDDERMLFDIQ+FYNVVIEELP+NVADLL
Sbjct: 369 GRSGRFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPANVADLL 414




ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|P41379|IF4A2_NICPL Eukaryotic initiation factor 4A-2 OS=Nicotiana plumbaginifolia PE=2 SV=1 Back     alignment and function description
>sp|Q40467|IF414_TOBAC Eukaryotic initiation factor 4A-14 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P41376|IF4A1_ARATH Eukaryotic initiation factor 4A-1 OS=Arabidopsis thaliana GN=TIF4A-1 PE=1 SV=1 Back     alignment and function description
>sp|P41381|IF4A8_TOBAC Eukaryotic initiation factor 4A-8 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P41382|IF410_TOBAC Eukaryotic initiation factor 4A-10 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q6Z2Z4|IF4A3_ORYSJ Eukaryotic initiation factor 4A-3 OS=Oryza sativa subsp. japonica GN=Os02g0146600 PE=2 SV=1 Back     alignment and function description
>sp|Q40465|IF411_TOBAC Eukaryotic initiation factor 4A-11 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q40471|IF4A9_TOBAC Eukaryotic initiation factor 4A-9 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P41377|IF4A2_ARATH Eukaryotic initiation factor 4A-2 OS=Arabidopsis thaliana GN=TIF4A-2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
255560725 413 dead box ATP-dependent RNA helicase, put 1.0 0.692 0.996 1e-165
283049400 413 DEAD-box RNA helicase-like protein [Prun 1.0 0.692 0.986 1e-164
224073500 413 predicted protein [Populus trichocarpa] 1.0 0.692 0.986 1e-164
359484301 803 PREDICTED: eukaryotic initiation factor 1.0 0.356 0.979 1e-163
297738640 413 unnamed protein product [Vitis vinifera] 1.0 0.692 0.979 1e-163
225429488 413 PREDICTED: eukaryotic initiation factor 1.0 0.692 0.972 1e-163
225442221 413 PREDICTED: eukaryotic initiation factor 1.0 0.692 0.979 1e-163
224153793 390 predicted protein [Populus trichocarpa] 1.0 0.733 0.979 1e-163
147779855 413 hypothetical protein VITISV_040122 [Viti 1.0 0.692 0.972 1e-163
449447868 413 PREDICTED: eukaryotic initiation factor 1.0 0.692 0.975 1e-162
>gi|255560725|ref|XP_002521376.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223539454|gb|EEF41044.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  588 bits (1515), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 285/286 (99%), Positives = 285/286 (99%)

Query: 1   MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 60
           MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV
Sbjct: 128 MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 187

Query: 61  LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 120
           LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE
Sbjct: 188 LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 247

Query: 121 LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 180
           LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS
Sbjct: 248 LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 307

Query: 181 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 240
           ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI
Sbjct: 308 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 367

Query: 241 GRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286
           GR GRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL
Sbjct: 368 GRGGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 413




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|283049400|gb|ADB07168.1| DEAD-box RNA helicase-like protein [Prunus persica] gi|283049402|gb|ADB07169.1| DEAD-box RNA helicase-like protein [Prunus persica] Back     alignment and taxonomy information
>gi|224073500|ref|XP_002304104.1| predicted protein [Populus trichocarpa] gi|118484805|gb|ABK94270.1| unknown [Populus trichocarpa] gi|222841536|gb|EEE79083.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359484301|ref|XP_002281247.2| PREDICTED: eukaryotic initiation factor 4A-15-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738640|emb|CBI27885.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225429488|ref|XP_002278119.1| PREDICTED: eukaryotic initiation factor 4A-11 [Vitis vinifera] gi|296081635|emb|CBI20640.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442221|ref|XP_002277703.1| PREDICTED: eukaryotic initiation factor 4A-2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224153793|ref|XP_002337398.1| predicted protein [Populus trichocarpa] gi|222838972|gb|EEE77323.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147779855|emb|CAN61608.1| hypothetical protein VITISV_040122 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449447868|ref|XP_004141688.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus] gi|449480559|ref|XP_004155930.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
TAIR|locus:2020078412 EIF4A-2 "eif4a-2" [Arabidopsis 1.0 0.694 0.965 6.6e-145
TAIR|locus:2030285414 AT1G72730 [Arabidopsis thalian 1.0 0.690 0.940 7.8e-142
TAIR|locus:2088237415 EIF4A1 "eukaryotic translation 0.923 0.636 0.973 3.3e-134
ZFIN|ZDB-GENE-040426-2802411 eif4a2 "eukaryotic translation 0.993 0.690 0.757 3.1e-115
UNIPROTKB|Q8JFP1407 EIF4A2 "Eukaryotic initiation 0.993 0.697 0.750 3.9e-115
UNIPROTKB|Q3SZ65407 EIF4A2 "Eukaryotic initiation 0.993 0.697 0.750 6.4e-115
UNIPROTKB|E2R3J1407 EIF4A2 "Uncharacterized protei 0.993 0.697 0.750 6.4e-115
UNIPROTKB|Q14240407 EIF4A2 "Eukaryotic initiation 0.993 0.697 0.750 6.4e-115
UNIPROTKB|Q9NZE6312 EIF4A2 "BM-010" [Homo sapiens 0.993 0.910 0.750 6.4e-115
UNIPROTKB|A6M930407 EIF4A2 "Eukaryotic translation 0.993 0.697 0.750 6.4e-115
TAIR|locus:2020078 EIF4A-2 "eif4a-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1416 (503.5 bits), Expect = 6.6e-145, P = 6.6e-145
 Identities = 276/286 (96%), Positives = 282/286 (98%)

Query:     1 MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 60
             MRALGDY GVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPD IKMFV
Sbjct:   127 MRALGDYQGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDCIKMFV 186

Query:    61 LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 120
             LDEADEMLSRGFKDQIYDIFQLLP K+QVGVFSATMPPEALEITRKFM+KPVRILVKRDE
Sbjct:   187 LDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRILVKRDE 246

Query:   121 LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 180
             LTLEGIKQFYVNVEKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS
Sbjct:   247 LTLEGIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 306

Query:   181 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 240
             ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRI
Sbjct:   307 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRI 366

Query:   241 GRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286
             GRSGRFGRKGVAINFVT DD+RMLFDIQKFYNVV+EELPSNVADLL
Sbjct:   367 GRSGRFGRKGVAINFVTLDDQRMLFDIQKFYNVVVEELPSNVADLL 412




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003743 "translation initiation factor activity" evidence=ISS
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
TAIR|locus:2030285 AT1G72730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088237 EIF4A1 "eukaryotic translation initiation factor 4A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2802 eif4a2 "eukaryotic translation initiation factor 4A, isoform 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8JFP1 EIF4A2 "Eukaryotic initiation factor 4A-II" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ65 EIF4A2 "Eukaryotic initiation factor 4A-II" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3J1 EIF4A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q14240 EIF4A2 "Eukaryotic initiation factor 4A-II" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NZE6 EIF4A2 "BM-010" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6M930 EIF4A2 "Eukaryotic translation initiation factor 4A isoform 2" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0UU86IF4A_PHANO3, ., 6, ., 4, ., 1, 30.73230.99300.7171N/Ano
Q40470IF4A7_TOBAC3, ., 6, ., 4, ., 1, 30.95451.00.6924N/Ano
Q6Z2Z4IF4A3_ORYSJ3, ., 6, ., 4, ., 1, 30.96501.00.6908yesno
P0CQ73FAL1_CRYNB3, ., 6, ., 4, ., 1, 30.71020.98950.7146N/Ano
P0CQ72FAL1_CRYNJ3, ., 6, ., 4, ., 1, 30.71020.98950.7146yesno
P35683IF4A1_ORYSJ3, ., 6, ., 4, ., 1, 30.97201.00.6908yesno
Q4R4Y9IF4A2_MACFA3, ., 6, ., 4, ., 1, 30.74730.99300.6960N/Ano
Q4WEB4FAL1_ASPFU3, ., 6, ., 4, ., 1, 30.68660.99300.7135yesno
Q41741IF4A_MAIZE3, ., 6, ., 4, ., 1, 30.94401.00.6975N/Ano
A5AAE5FAL1_ASPNC3, ., 6, ., 4, ., 1, 30.68660.99300.7117yesno
A4QVP2IF4A_MAGO73, ., 6, ., 4, ., 1, 30.73230.99300.7171N/Ano
Q40471IF4A9_TOBAC3, ., 6, ., 4, ., 1, 30.96151.00.6924N/Ano
Q4P331IF4A_USTMA3, ., 6, ., 4, ., 1, 30.73230.99300.6909N/Ano
Q2UAK1FAL1_ASPOR3, ., 6, ., 4, ., 1, 30.68660.99300.7135yesno
P41382IF410_TOBAC3, ., 6, ., 4, ., 1, 30.96501.00.6924N/Ano
Q5AUL4FAL1_EMENI3, ., 6, ., 4, ., 1, 30.68660.99300.7117yesno
P41381IF4A8_TOBAC3, ., 6, ., 4, ., 1, 30.96151.00.6924N/Ano
P47943IF4A_SCHPO3, ., 6, ., 4, ., 1, 30.72880.99300.7244yesno
Q5R4X1IF4A2_PONAB3, ., 6, ., 4, ., 1, 30.75080.99300.6977yesno
Q14240IF4A2_HUMAN3, ., 6, ., 4, ., 1, 30.75080.99300.6977yesno
P41377IF4A2_ARATH3, ., 6, ., 4, ., 1, 30.96501.00.6941yesno
P41376IF4A1_ARATH3, ., 6, ., 4, ., 1, 30.97201.00.6941yesno
Q40467IF414_TOBAC3, ., 6, ., 4, ., 1, 30.96501.00.6924N/Ano
Q40466IF413_TOBAC3, ., 6, ., 4, ., 1, 30.96490.79720.6422N/Ano
Q40465IF411_TOBAC3, ., 6, ., 4, ., 1, 30.96501.00.6924N/Ano
Q40469IF4A6_TOBAC3, ., 6, ., 4, ., 1, 30.96440.88461.0N/Ano
Q40468IF415_TOBAC3, ., 6, ., 4, ., 1, 30.95801.00.6924N/Ano
P41379IF4A2_NICPL3, ., 6, ., 4, ., 1, 30.97201.00.6924N/Ano
Q5RKI1IF4A2_RAT3, ., 6, ., 4, ., 1, 30.75080.99300.6977yesno
Q9CAI7IF4A3_ARATH3, ., 6, ., 4, ., 1, 30.94051.00.6908nono
Q5R5F5IF4A1_PONAB3, ., 6, ., 4, ., 1, 30.74730.99300.6995yesno
Q4R8K5IF4A1_MACFA3, ., 6, ., 4, ., 1, 30.74380.99300.6995N/Ano
P41378IF4A_WHEAT3, ., 6, ., 4, ., 1, 30.95801.00.6908N/Ano
P27639IF4A_CAEEL3, ., 6, ., 4, ., 1, 30.68881.00.7114yesno
Q3SZ65IF4A2_BOVIN3, ., 6, ., 4, ., 1, 30.75080.99300.6977yesno
Q8JFP1IF4A2_CHICK3, ., 6, ., 4, ., 1, 30.75080.99300.6977yesno
Q7RV88IF4A_NEUCR3, ., 6, ., 4, ., 1, 30.73230.99300.7153N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.991
3rd Layer3.6.40.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-172
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-102
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 6e-70
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-55
cd00268203 cd00268, DEADc, DEAD-box helicases 7e-54
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-49
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-49
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 5e-47
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-43
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 6e-43
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 2e-42
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 4e-40
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 4e-39
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 2e-29
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-28
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 8e-28
smart0049082 smart00490, HELICc, helicase superfamily c-termina 6e-27
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 6e-21
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 2e-15
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 9e-12
TIGR00614 470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 2e-10
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 9e-10
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 6e-09
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 2e-08
COG1205 851 COG1205, COG1205, Distinct helicase family with a 8e-07
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 1e-05
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 2e-05
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicas 1e-04
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 6e-04
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 8e-04
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 0.001
TIGR00631655 TIGR00631, uvrb, excinuclease ABC, B subunit 0.002
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication 0.004
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
 Score =  480 bits (1237), Expect = e-172
 Identities = 209/284 (73%), Positives = 238/284 (83%)

Query: 3   ALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLD 62
           ALGDYL V+ HACVGGT VR+D   L+AGVH+VVGTPGRV+DM+ ++ LR D +K+F+LD
Sbjct: 118 ALGDYLKVRCHACVGGTVVRDDINKLKAGVHMVVGTPGRVYDMIDKRHLRVDDLKLFILD 177

Query: 63  EADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELT 122
           EADEMLSRGFK QIYD+F+ LP  VQV +FSATMP E LE+T KFM  P RILVK+DELT
Sbjct: 178 EADEMLSRGFKGQIYDVFKKLPPDVQVALFSATMPNEILELTTKFMRDPKRILVKKDELT 237

Query: 123 LEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSAT 182
           LEGI+QFYV VEKEEWK +TLCDLYETL ITQ++I+ NTRRKVD+LT KM  RD TVS  
Sbjct: 238 LEGIRQFYVAVEKEEWKFDTLCDLYETLTITQAIIYCNTRRKVDYLTKKMHERDFTVSCM 297

Query: 183 HGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGR 242
           HGDMDQ  RD+IMREFRSGS+RVLITTDLLARGIDVQQVSLVINYDLP  PENY+HRIGR
Sbjct: 298 HGDMDQKDRDLIMREFRSGSTRVLITTDLLARGIDVQQVSLVINYDLPASPENYIHRIGR 357

Query: 243 SGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286
           SGRFGRKGVAINFVT DD   L +I++ YN  IEE+P  VAD L
Sbjct: 358 SGRFGRKGVAINFVTPDDIEQLKEIERHYNTQIEEMPMEVADYL 401


Length = 401

>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|233063 TIGR00631, uvrb, excinuclease ABC, B subunit Back     alignment and domain information
>gnl|CDD|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00110545 helicase; Provisional 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0346 569 consensus RNA helicase [RNA processing and modific 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0347 731 consensus RNA helicase [RNA processing and modific 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.98
PRK01172 674 ski2-like helicase; Provisional 99.97
PHA02653 675 RNA helicase NPH-II; Provisional 99.97
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.97
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.97
PHA02558501 uvsW UvsW helicase; Provisional 99.97
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.96
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.96
PRK13766 773 Hef nuclease; Provisional 99.96
COG1202 830 Superfamily II helicase, archaea-specific [General 99.96
COG1204 766 Superfamily II helicase [General function predicti 99.96
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.96
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.95
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.95
PRK09401 1176 reverse gyrase; Reviewed 99.95
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.95
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.95
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.95
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.95
PRK14701 1638 reverse gyrase; Provisional 99.94
KOG0354 746 consensus DEAD-box like helicase [General function 99.94
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.94
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.94
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.94
PRK04914 956 ATP-dependent helicase HepA; Validated 99.94
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.93
COG1205 851 Distinct helicase family with a unique C-terminal 99.93
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.93
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.93
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.92
PRK05580 679 primosome assembly protein PriA; Validated 99.92
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.92
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.91
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.91
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.91
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.88
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.88
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.88
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.88
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.88
PRK09694 878 helicase Cas3; Provisional 99.88
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.88
PRK05298652 excinuclease ABC subunit B; Provisional 99.88
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.87
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.87
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.86
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.85
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.85
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.84
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.84
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.82
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.82
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.82
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.79
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.79
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.79
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.78
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.77
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.74
KOG1123776 consensus RNA polymerase II transcription initiati 99.74
smart0049082 HELICc helicase superfamily c-terminal domain. 99.72
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.71
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.69
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.66
COG4096 875 HsdR Type I site-specific restriction-modification 99.66
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.66
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.64
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.64
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.63
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.61
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.6
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.6
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.59
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.58
KOG0387 923 consensus Transcription-coupled repair protein CSB 99.57
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.55
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.52
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.49
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.44
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.41
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.4
PRK14873665 primosome assembly protein PriA; Provisional 99.37
COG4889 1518 Predicted helicase [General function prediction on 99.35
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.35
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.34
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.33
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.31
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.31
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.29
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 99.15
smart00487201 DEXDc DEAD-like helicases superfamily. 99.02
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.0
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.9
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 98.9
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.84
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.81
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.81
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.79
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.78
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.74
KOG2340698 consensus Uncharacterized conserved protein [Funct 98.69
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.62
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 98.57
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.53
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.52
COG0610 962 Type I site-specific restriction-modification syst 98.49
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.45
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 98.41
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 98.31
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.29
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.19
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.09
KOG4439901 consensus RNA polymerase II transcription terminat 98.04
smart00492141 HELICc3 helicase superfamily c-terminal domain. 98.02
smart00491142 HELICc2 helicase superfamily c-terminal domain. 98.01
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.7
PF13871 278 Helicase_C_4: Helicase_C-like 97.62
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.48
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 97.26
PRK14873 665 primosome assembly protein PriA; Provisional 96.89
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 96.75
PRK05580 679 primosome assembly protein PriA; Validated 96.71
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.68
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 96.61
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 96.29
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 96.25
COG1198 730 PriA Primosomal protein N' (replication factor Y) 96.21
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 96.21
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 95.97
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 95.85
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 95.8
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 95.79
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 95.76
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 95.65
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 95.56
PRK10689 1147 transcription-repair coupling factor; Provisional 95.29
KOG1002 791 consensus Nucleotide excision repair protein RAD16 94.99
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 94.96
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 94.83
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 94.35
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 94.2
KOG4439 901 consensus RNA polymerase II transcription terminat 94.07
PRK14701 1638 reverse gyrase; Provisional 94.01
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 93.93
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 93.9
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 93.6
KOG1001674 consensus Helicase-like transcription factor HLTF/ 93.5
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 93.36
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 93.05
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 92.98
smart00489289 DEXDc3 DEAD-like helicases superfamily. 92.87
smart00488289 DEXDc2 DEAD-like helicases superfamily. 92.87
KOG0330 476 consensus ATP-dependent RNA helicase [RNA processi 92.4
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 91.7
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 91.69
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 91.67
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 91.57
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 91.4
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 91.38
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 91.37
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 91.22
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 90.64
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 90.36
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 89.64
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 89.5
PRK05642234 DNA replication initiation factor; Validated 89.29
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 89.26
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 89.06
KOG0347 731 consensus RNA helicase [RNA processing and modific 88.95
KOG0388 1185 consensus SNF2 family DNA-dependent ATPase [Replic 88.89
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 88.81
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 88.76
KOG02981394 consensus DEAD box-containing helicase-like transc 88.75
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 88.49
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 88.23
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 87.77
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 87.69
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 87.54
PRK08084235 DNA replication initiation factor; Provisional 87.31
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 86.65
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 86.2
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 86.09
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 85.93
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 85.9
PRK12422445 chromosomal replication initiation protein; Provis 85.88
PF13173128 AAA_14: AAA domain 85.76
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 85.23
PRK08727233 hypothetical protein; Validated 85.22
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 84.91
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 84.91
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 84.83
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 84.76
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 84.71
COG3973747 Superfamily I DNA and RNA helicases [General funct 84.59
PRK06893229 DNA replication initiation factor; Validated 84.3
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 84.28
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 84.18
KOG0350 620 consensus DEAD-box ATP-dependent RNA helicase [RNA 84.08
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 84.07
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 84.01
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 83.68
PRK09401 1176 reverse gyrase; Reviewed 83.27
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 83.25
KOG0343 758 consensus RNA Helicase [RNA processing and modific 83.05
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 82.95
PRK14087450 dnaA chromosomal replication initiation protein; P 82.79
PHA03368 738 DNA packaging terminase subunit 1; Provisional 82.46
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 82.15
KOG0340 442 consensus ATP-dependent RNA helicase [RNA processi 82.0
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 81.95
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 81.76
COG1205 851 Distinct helicase family with a unique C-terminal 81.75
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 81.48
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 81.31
KOG3089271 consensus Predicted DEAD-box-containing helicase [ 81.17
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 80.87
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 80.68
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 80.59
KOG0298 1394 consensus DEAD box-containing helicase-like transc 80.49
PTZ00110 545 helicase; Provisional 80.4
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 80.23
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 80.15
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=100.00  E-value=1.1e-51  Score=314.82  Aligned_cols=285  Identities=68%  Similarity=1.104  Sum_probs=277.2

Q ss_pred             cccccccCceEEEEEcCcchHHHHHHHhCCCcEEEeCcHHHHHHHhcCCCCCCCccEEEEehhhHhhccccHHHHHHHHH
Q 023177            2 RALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQ   81 (286)
Q Consensus         2 ~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~iii~Tp~~l~~~~~~~~~~~~~~~~iIiDE~h~~~~~~~~~~~~~i~~   81 (286)
                      ..++...++.++.+.||++..+..+.+.-+.+++.+||+++++++++..+....++++|+||++.+++.++..++-.+.+
T Consensus       116 ~alg~~mnvq~hacigg~n~gedikkld~G~hvVsGtPGrv~dmikr~~L~tr~vkmlVLDEaDemL~kgfk~Qiydiyr  195 (400)
T KOG0328|consen  116 LALGDYMNVQCHACIGGKNLGEDIKKLDYGQHVVSGTPGRVLDMIKRRSLRTRAVKMLVLDEADEMLNKGFKEQIYDIYR  195 (400)
T ss_pred             HHhcccccceEEEEecCCccchhhhhhcccceEeeCCCchHHHHHHhccccccceeEEEeccHHHHHHhhHHHHHHHHHH
Confidence            35778889999999999999999999988999999999999999999999999999999999999999999999999999


Q ss_pred             hCCcCccEEEEEeecChhHHHHHHHhcCCCeEEEecCCccccccceeEEEEccchhhHHHHHHHHHhhccCcceEEEecc
Q 023177           82 LLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNT  161 (286)
Q Consensus        82 ~~~~~~~~i~~SAT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~l~~~~~~~~~~~~ivf~~~  161 (286)
                      ++|+.+|++++|||++.+..+....+..+|+.+...+++...+.+.+++..++.+++|.+.++.++....-..++|||++
T Consensus       196 ~lp~~~Qvv~~SATlp~eilemt~kfmtdpvrilvkrdeltlEgIKqf~v~ve~EewKfdtLcdLYd~LtItQavIFcnT  275 (400)
T KOG0328|consen  196 YLPPGAQVVLVSATLPHEILEMTEKFMTDPVRILVKRDELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNT  275 (400)
T ss_pred             hCCCCceEEEEeccCcHHHHHHHHHhcCCceeEEEecCCCchhhhhhheeeechhhhhHhHHHHHhhhhehheEEEEecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHhcCCCeeEEecCCCCHHHHHHHHHHhhcCCCcEEEEecCCccCCCCCCCcEEEEccCCCCcchhhhhhc
Q 023177          162 RRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIG  241 (286)
Q Consensus       162 ~~~~~~l~~~l~~~~~~~~~~~~~~~~~~r~~~~~~f~~~~~~vlv~T~~~~~Gidi~~~~~vi~~~~~~s~~~~~Q~~G  241 (286)
                      +..+.++.+.+++.+..+...||+|++++|..++..|++|+.+|||+|++-++|+|+|.++.||.||.|.+...|+||+|
T Consensus       276 k~kVdwLtekm~~~nftVssmHGDm~qkERd~im~dFRsg~SrvLitTDVwaRGiDv~qVslviNYDLP~nre~YIHRIG  355 (400)
T KOG0328|consen  276 KRKVDWLTEKMREANFTVSSMHGDMEQKERDKIMNDFRSGKSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIG  355 (400)
T ss_pred             cchhhHHHHHHHhhCceeeeccCCcchhHHHHHHHHhhcCCceEEEEechhhccCCcceeEEEEecCCCccHHHHhhhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCcceEEEEeccCcHHHHHHHHHHhchhcccCCcchhccC
Q 023177          242 RSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL  286 (286)
Q Consensus       242 R~~R~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~  286 (286)
                      |.||.|..|.++-|+..+|.+.+..+++++...+.+.|..+++++
T Consensus       356 RSGRFGRkGvainFVk~~d~~~lrdieq~yst~i~emp~nvad~i  400 (400)
T KOG0328|consen  356 RSGRFGRKGVAINFVKSDDLRILRDIEQYYSTQIDEMPMNVADLI  400 (400)
T ss_pred             cccccCCcceEEEEecHHHHHHHHHHHHHHhhhcccccchhhhcC
Confidence            999999999999999999999999999999999999999998875



>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3089 consensus Predicted DEAD-box-containing helicase [General function prediction only] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 1e-119
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 1e-118
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-115
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-115
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-115
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-115
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-114
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-114
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-98
1fuu_A394 Yeast Initiation Factor 4a Length = 394 5e-94
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 6e-59
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 9e-54
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 9e-54
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 1e-53
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 2e-53
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-52
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 3e-52
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 4e-52
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 4e-52
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 5e-51
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 1e-50
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 2e-50
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 5e-42
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 8e-42
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 1e-41
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 7e-39
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 3e-38
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 2e-36
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 3e-36
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 5e-36
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 2e-35
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 2e-35
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 4e-34
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 6e-34
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 3e-29
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 2e-28
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 1e-25
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 2e-25
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 2e-25
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 2e-25
2jgn_A185 Ddx3 Helicase Domain Length = 185 3e-21
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 9e-21
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 1e-18
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 1e-17
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 5e-17
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 2e-16
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 1e-15
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 3e-15
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 3e-15
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 3e-15
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 5e-15
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 5e-15
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 3e-14
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 2e-13
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 1e-10
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 2e-10
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 3e-10
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 3e-10
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 6e-10
1oyy_A 523 Structure Of The Recq Catalytic Core Bound To Atp-G 3e-09
1oyw_A 523 Structure Of The Recq Catalytic Core Length = 523 3e-09
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-08
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 2e-08
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 4e-08
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 1e-07
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 2e-06
4gl2_A 699 Structural Basis For Dsrna Duplex Backbone Recognit 2e-05
4ay2_A 687 Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I 1e-04
2ykg_A 696 Structural Insights Into Rna Recognition By Rig-I L 1e-04
3tmi_A 695 Structural Basis For Rna Recognition And Activation 1e-04
2v1x_A 591 Crystal Structure Of Human Recq-Like Dna Helicase L 2e-04
4i1s_A243 Melanoma Differentiation Associated Protein-5 Helic 3e-04
1wp9_A494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 9e-04
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure

Iteration: 1

Score = 423 bits (1088), Expect = e-119, Method: Compositional matrix adjust. Identities = 213/285 (74%), Positives = 244/285 (85%), Gaps = 1/285 (0%) Query: 3 ALGDYLGVKVHACVGGTSVR-EDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVL 61 ALGDY+G HAC+GGT+VR E Q++ H++VGTPGRVFDML R+ L P YIKMFVL Sbjct: 104 ALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVL 163 Query: 62 DEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDEL 121 DEADEMLSRGFKDQIYDIFQ L + QV + SATMP + LE+T+KFM P+RILVK++EL Sbjct: 164 DEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEEL 223 Query: 122 TLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSA 181 TLEGI+QFY+NVE+EEWKL+TLCDLYETL ITQ+VIF+NTRRKVDWLT+KM +RD TVSA Sbjct: 224 TLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSA 283 Query: 182 THGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIG 241 HGDMDQ RD+IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPT ENY+HRIG Sbjct: 284 MHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIG 343 Query: 242 RSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286 R GRFGRKGVAIN VT +D+R L DI+ FYN IEE+P NVADL+ Sbjct: 344 RGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 388
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 Back     alignment and structure
>pdb|4AY2|A Chain A, Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I Length = 687 Back     alignment and structure
>pdb|2YKG|A Chain A, Structural Insights Into Rna Recognition By Rig-I Length = 696 Back     alignment and structure
>pdb|3TMI|A Chain A, Structural Basis For Rna Recognition And Activation Of Rig-I Length = 695 Back     alignment and structure
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure
>pdb|4I1S|A Chain A, Melanoma Differentiation Associated Protein-5 Helicase Domain Complex With Inhibitor Non-structural Protein V Length = 243 Back     alignment and structure
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 0.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 0.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 0.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 0.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 0.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-176
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-174
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-173
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-166
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 1e-116
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 1e-109
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-104
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-101
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 5e-98
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 4e-97
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 2e-88
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-87
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 6e-82
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 2e-80
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 2e-76
3bor_A237 Human initiation factor 4A-II; translation initiat 5e-73
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 4e-62
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 2e-61
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 1e-58
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 9e-58
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 6e-57
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 2e-55
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 8e-55
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 3e-53
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 4e-45
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 2e-44
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 4e-43
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 4e-38
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 5e-35
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 6e-30
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 7e-29
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 9e-29
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-28
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-27
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 4e-25
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-24
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-06
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 4e-14
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 3e-11
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 9e-11
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 2e-10
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-10
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 3e-10
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 4e-08
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 4e-08
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 1e-07
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 3e-07
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 7e-05
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 8e-05
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 2e-04
1yks_A 440 Genome polyprotein [contains: flavivirin protease 3e-04
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
 Score =  537 bits (1386), Expect = 0.0
 Identities = 193/286 (67%), Positives = 236/286 (82%)

Query: 1   MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 60
           + ALGDY+ V+ HAC+GGT+V ED R L  G HVV GTPGRVFDM+RR+SLR   IKM V
Sbjct: 125 LLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV 184

Query: 61  LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 120
           LDEADEML++GFK+QIYD+++ LP   QV + SAT+P E LE+T KFM  P+RILVKRDE
Sbjct: 185 LDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDE 244

Query: 121 LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 180
           LTLEGIKQF+V VE+EEWK +TLCDLY+TL ITQ+VIF NT+RKVDWLT+KMR  + TVS
Sbjct: 245 LTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVS 304

Query: 181 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 240
           + HGDM Q  R+ IM+EFRSG+SRVLI+TD+ ARG+DV QVSL+INYDLP   E Y+HRI
Sbjct: 305 SMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRI 364

Query: 241 GRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286
           GRSGR+GRKGVAINFV  DD R+L DI+++Y+  I+E+P NVADL+
Sbjct: 365 GRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 410


>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Length = 677 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.98
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.98
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.98
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.98
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.97
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.97
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.97
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.97
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.97
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.97
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.97
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.97
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.97
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.97
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.97
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.96
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.96
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.96
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.96
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.96
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.96
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.92
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.95
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.95
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.95
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.95
3h1t_A590 Type I site-specific restriction-modification syst 99.95
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.95
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.95
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.94
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.94
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.93
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.92
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.91
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.88
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.84
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.74
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.72
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.72
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.69
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.68
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.68
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.67
3bor_A237 Human initiation factor 4A-II; translation initiat 99.67
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.67
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.66
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.65
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.64
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.64
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.63
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.56
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.51
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.34
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.08
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.05
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.95
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 98.78
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.72
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.53
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 98.25
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 96.01
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 95.46
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 94.2
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 94.1
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 94.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 93.42
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 93.29
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 92.92
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 92.35
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 91.61
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 90.5
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 89.85
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 89.2
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 88.46
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 88.43
3bor_A237 Human initiation factor 4A-II; translation initiat 88.41
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 87.61
2l82_A162 Designed protein OR32; structural genomics, northe 87.04
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 85.4
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 85.25
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 84.25
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 83.45
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 83.16
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 82.89
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 82.72
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 81.63
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 80.87
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 80.62
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 80.41
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=6.1e-47  Score=326.52  Aligned_cols=282  Identities=31%  Similarity=0.529  Sum_probs=254.6

Q ss_pred             cccccccCceEEEEEcCcchHHHHHHHhCCCcEEEeCcHHHHHHHhcCCCCCCCccEEEEehhhHhhccccHHHHHHHHH
Q 023177            2 RALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQ   81 (286)
Q Consensus         2 ~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~iii~Tp~~l~~~~~~~~~~~~~~~~iIiDE~h~~~~~~~~~~~~~i~~   81 (286)
                      +++....++++..++|+.+...+...+..+++|+|+||++|.+++.+....+.+++++|+||||++.++++...+..++.
T Consensus       150 ~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~  229 (434)
T 2db3_A          150 RKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMT  229 (434)
T ss_dssp             HHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSCCCTTCCEEEEETHHHHTSTTTHHHHHHHHH
T ss_pred             HHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCcccccCCeEEEccHhhhhccCcHHHHHHHHH
Confidence            34566678899999999999888888888999999999999999998888899999999999999999999999999988


Q ss_pred             hC--CcCccEEEEEeecChhHHHHHHHhcCCCeEEEecCCccccccceeEEEEccchhhHHHHHHHHHhhccCcceEEEe
Q 023177           82 LL--PAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFV  159 (286)
Q Consensus        82 ~~--~~~~~~i~~SAT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~l~~~~~~~~~~~~ivf~  159 (286)
                      ..  +...|++++|||+++........++.++..+...........+.+.+..+.... +...+..++..... ++||||
T Consensus       230 ~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~~~~~~~~~~-k~~~l~~~l~~~~~-~~lVF~  307 (434)
T 2db3_A          230 HVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYA-KRSKLIEILSEQAD-GTIVFV  307 (434)
T ss_dssp             CTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTCCCTTEEEEEEECCGGG-HHHHHHHHHHHCCT-TEEEEC
T ss_pred             hcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccccccccceEEEEeCcHH-HHHHHHHHHHhCCC-CEEEEE
Confidence            75  567899999999999999999999988888888776666677888887777665 77777777776653 599999


Q ss_pred             cchhhHHHHHHHHhcCCCeeEEecCCCCHHHHHHHHHHhhcCCCcEEEEecCCccCCCCCCCcEEEEccCCCCcchhhhh
Q 023177          160 NTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHR  239 (286)
Q Consensus       160 ~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~r~~~~~~f~~~~~~vlv~T~~~~~Gidi~~~~~vi~~~~~~s~~~~~Q~  239 (286)
                      ++++.|+.+++.|.+.++.+..+||++++.+|..+++.|++|+.+|||||+++++|+|+|++++||++|+|.+..+|+||
T Consensus       308 ~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~d~p~~~~~y~qr  387 (434)
T 2db3_A          308 ETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHR  387 (434)
T ss_dssp             SSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEESSCCSSHHHHHHH
T ss_pred             eCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEECCCCCHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcccccCCCcceEEEEecc-CcHHHHHHHHHHhchhcccCCcchhcc
Q 023177          240 IGRSGRFGRKGVAINFVTR-DDERMLFDIQKFYNVVIEELPSNVADL  285 (286)
Q Consensus       240 ~GR~~R~~~~g~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~l~~l  285 (286)
                      +||+||.|+.|.+++++++ .+......+.+.+....+++|++|.++
T Consensus       388 iGR~gR~g~~G~a~~~~~~~~~~~~~~~l~~~l~~~~~~vp~~l~~~  434 (434)
T 2db3_A          388 IGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRTC  434 (434)
T ss_dssp             HTTSSCTTCCEEEEEEECTTTCGGGHHHHHHHHHHTTCCCCGGGC--
T ss_pred             hcccccCCCCCEEEEEEeccccHHHHHHHHHHHHHcCCCCCHHHHhC
Confidence            9999999999999999994 578889999999999999999999764



>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 4e-46
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 2e-45
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 5e-39
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 2e-36
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 1e-34
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 6e-34
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 1e-32
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 3e-28
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-26
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 6e-26
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 1e-25
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 2e-25
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-25
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-22
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 3e-20
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 4e-20
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 6e-20
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 6e-20
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 1e-19
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 4e-19
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-18
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 2e-15
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 3e-14
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 3e-13
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 1e-09
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 3e-09
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 2e-07
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 5e-07
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 1e-05
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 4e-05
d2eyqa5211 c.37.1.19 (A:779-989) Transcription-repair couplin 6e-05
d1tf5a4175 c.37.1.19 (A:396-570) Translocation ATPase SecA, n 8e-04
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 0.004
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  150 bits (380), Expect = 4e-46
 Identities = 109/161 (67%), Positives = 134/161 (83%)

Query: 126 IKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGD 185
           IKQFYVNVE+EE+K E L DLY+++++TQ+VIF NTRRKV+ LT K+R+   TVSA + D
Sbjct: 1   IKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSD 60

Query: 186 MDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGR 245
           + Q  RD IM+EFRSGSSR+LI+TDLLARGIDVQQVSLVINYDLP   ENY+HRIGR GR
Sbjct: 61  LPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGR 120

Query: 246 FGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286
           FGRKGVAINFVT +D   + +++KFY+  IEELPS++A LL
Sbjct: 121 FGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLL 161


>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 100.0
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.97
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.95
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.94
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.91
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.9
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.88
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.87
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.86
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.86
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.86
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.81
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.8
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.76
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.75
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.74
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.71
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.68
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.66
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.65
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.65
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.64
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.64
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.63
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.58
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.48
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.22
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.04
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 99.0
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.98
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.85
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.79
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.69
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.66
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.27
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.23
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.04
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.45
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.42
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.21
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 96.67
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 96.61
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 96.46
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 93.81
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.64
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 92.01
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 91.74
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 89.28
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 88.73
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 87.39
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 86.03
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 85.83
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 84.04
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 83.76
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 82.71
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 81.09
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 80.78
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=2.3e-36  Score=222.63  Aligned_cols=161  Identities=68%  Similarity=1.042  Sum_probs=151.0

Q ss_pred             ceeEEEEccchhhHHHHHHHHHhhccCcceEEEecchhhHHHHHHHHhcCCCeeEEecCCCCHHHHHHHHHHhhcCCCcE
Q 023177          126 IKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRV  205 (286)
Q Consensus       126 i~~~~~~~~~~~~~~~~l~~~~~~~~~~~~ivf~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~r~~~~~~f~~~~~~v  205 (286)
                      +.|++..+...+.|++.+..+++..+..++||||+++..++.+++.|...++.+..+||+++..+|..+++.|+.|+.++
T Consensus         1 I~q~~~~v~~~e~K~~~L~~ll~~~~~~k~iIF~~s~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~l~~f~~~~~~i   80 (162)
T d1fuka_           1 IKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRI   80 (162)
T ss_dssp             CEEEEEEEESGGGHHHHHHHHHHHTTCSCEEEEESSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTTSCSE
T ss_pred             CEEEEEEeCCcHHHHHHHHHHHHhCCCCcEEEEEEEEchHHHHHHHHhhcCceEEEeccCCchhhHHHHHHHHhhcccce
Confidence            46888889888889999999999998899999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecCCccCCCCCCCcEEEEccCCCCcchhhhhhcccccCCCcceEEEEeccCcHHHHHHHHHHhchhcccCCcchhcc
Q 023177          206 LITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADL  285 (286)
Q Consensus       206 lv~T~~~~~Gidi~~~~~vi~~~~~~s~~~~~Q~~GR~~R~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l  285 (286)
                      ||||+++++|+|+|++++||++|+|+++..|+||+||+||.|+.|.+++++++.+...+..+++.++..++++|+++.++
T Consensus        81 Lv~Tdv~~rGiDi~~v~~VI~~d~P~~~~~yihR~GR~gR~g~~g~~i~~~~~~d~~~~~~i~~~~~~~~~~ip~~~~~l  160 (162)
T d1fuka_          81 LISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL  160 (162)
T ss_dssp             EEEEGGGTTTCCCCSCSEEEESSCCSSGGGGGGSSCSCC-----CEEEEEEETTTHHHHHHHHHHSSCCCEECCSCCTTT
T ss_pred             eeccccccccccCCCceEEEEeccchhHHHHHhhccccccCCCccEEEEEcCHHHHHHHHHHHHHHcCcCCCCChHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             C
Q 023177          286 L  286 (286)
Q Consensus       286 ~  286 (286)
                      |
T Consensus       161 ~  161 (162)
T d1fuka_         161 L  161 (162)
T ss_dssp             T
T ss_pred             h
Confidence            6



>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure