Citrus Sinensis ID: 023201


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MASLTSISQSQSFLMKPHLINTAITSARPNYFSSNFLPLWSRSFFKLPRMTQKNGVVVVSATTAEKPKKRYPGEAKGFVEEMRFVAMKLHTKEQAREGEKEVKEPEERPVTKWEPTVDGYLRFLVDSKLVYDTLEGIIEKAPFPSYAEFRNTGLERSEKLAKDLEWFKEQGYTIPEPSSPGISYVQYLEELSEKDPQAFICHFYNIYFAHSAGGRMIGKKVAEKILGGKELEFYKWDGELPKLLQNVRDKLNKVAESWTREEKNRCLEETELSFKHSGEILRLILS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHccHHHHHccHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHc
*****************************NYFSSNFLPLWSRSFFKLPRMTQKNGVVVVSA****************FVEEMRFVAMKLH*******************VTKWEPTVDGYLRFLVDSKLVYDTLEGIIEKAPFPSYAEFRNTGLERSEKLAKDLEWFKEQGYTIPEPSSPGISYVQYLEELSEKDPQAFICHFYNIYFAHSAGGRMIGKKVAEKILGGKELEFYKWDGELPKLLQNVRDKLNKVAESWTREEKNRCLEETELSFKHSGEILRLILS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLTSISQSQSFLMKPHLINTAITSARPNYFSSNFLPLWSRSFFKLPRMTQKNGVVVVSATTAEKPKKRYPGEAKGFVEEMRFVAMKLHTKEQAREGEKEVKEPEERPVTKWEPTVDGYLRFLVDSKLVYDTLEGIIEKAPFPSYAEFRNTGLERSEKLAKDLEWFKEQGYTIPEPSSPGISYVQYLEELSEKDPQAFICHFYNIYFAHSAGGRMIGKKVAEKILGGKELEFYKWDGELPKLLQNVRDKLNKVAESWTREEKNRCLEETELSFKHSGEILRLILS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heme oxygenase 1, chloroplastic Key enzyme in the synthesis of the chromophore of the phytochrome family of plant photoreceptors. Catalyzes the opening of the heme ring to form the open-chain tetrapyrrole biliverdin IX with the release of iron and carbon monoxide (CO). Produces specifically the biliverdin IX-alpha isomer. Can form complex with heme, is ferredoxin-dependent and its activity is increased in the presence of ascorbate. Plays a role in salt acclimation signaling. May affect the plastid-to-nucleus signaling pathway by perturbing tetrapyrrole synthesis. The plastid-to-nucleus signal plays an important role in the coordinated expression of both nuclear- and chloroplast-localized genes that encode photosynthesis-related proteins.confidentO48782
Heme oxygenase 1, chloroplastic Catalyzes the opening of the heme ring to form the open-chain tetrapyrrole biliverdin IX with the release of iron and carbon monoxide (CO). Is a key enzyme in the synthesis of the chromophore of the phytochrome family of plant photoreceptors. Essential for photoperiod response and repression of flowering through cytochromes that inhibit flowering by affecting both HD1 and EHD1 flowering pathways.probableQ69XJ4
Heme oxygenase 3, chloroplastic Catalyzes the opening of the heme ring to form the open-chain tetrapyrrole biliverdin IX with the release of iron and carbon monoxide (CO). Produces specifically the biliverdin IX-alpha isomer. Plays a minor role in phytochrome assembly and photomorphogenesis.probableQ9C9L4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WOV, chain A
Confidence level:very confident
Coverage over the Query: 76-285
View the alignment between query and template
View the model in PyMOL