Citrus Sinensis ID: 023212


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----
MDDRISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSDPYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFAVDKRVQRLELDFSESKTEGHELHTFSPYFKTTSSFSSLVSLRLIDVDIPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSNLEINAPNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLMAVSVS
cccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccccccEEEEEEEEEcHHHHHHHHHcccccEEEEEEccccccEEEEEcccccEEEEEEEEcccccEEEEEcccccEEEEEEccEEEEEcccccEEEEEEEEEEEccHHHHHHHHccccccccEEEEEEccEEcc
cccHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEccccccccccccccEEcccccccccccEEEEEEEEccHHHHHHHHHcccHHHEEEEEEcccccEEEEEEccccEEEEEEEccccccEEEEEccccEEEEEccccEEEEEEcccccEEEEEEEccccccEEEccccccccccEEEEEEEEEEEEEc
mddrisklpddILICILSRLTIEEAARASILSYRWRYLWRFFtgsldfvdpykIRRLAilsdpyykcednyfIRVKRRNFINLVDPILGLLQTKSLQQLricypvnsdydvdsWVQFAVDKRVQRLeldfseskteghelhtfspyfkttssFSSLVSLrlidvdipEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVSgpslklkylelrdlpnlsnleinapnlvsfefsAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLMAVSVS
mddrisklpddiLICILSRLTIEEAARASILSYRWRYLWRFFtgsldfvdpYKIRRlailsdpyykcEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFAVDKRVQRLELDfseskteghelhtfspyfkTTSSFSSLVSLRLIDVDIPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRvsgpslklkyLELRDLPNLSNLEINAPNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLMAVSVS
MDDRISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSDPYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFAVDKRVQRLELDFSESKTEGHELHTFSPYFKTTSSFSSLVSLRLIDVDIPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSNLEINAPNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLMAVSVS
*********DDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSDPYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFAVDKRVQRLELDFS*****GHELHTFSPYFKTTSSFSSLVSLRLIDVDIPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSNLEINAPNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLMA****
MDDRISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSDPYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFAVDKRVQRLELDFSESKTEGHELHTFSPYFKTTSSFSSLVSLRLIDVDIPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSNLEINAPNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLMAVSVS
MDDRISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSDPYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFAVDKRVQRLELDFSESKTEGHELHTFSPYFKTTSSFSSLVSLRLIDVDIPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSNLEINAPNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLMAVSVS
**D*ISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIR*****SDPYYKCED*YFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFAVDKRVQRLELDFSESKTEGHELHTFSPYFKTTSSFSSLVSLRLIDVDIPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSNLEINAPNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLMAVSVS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDRISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSDPYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFAVDKRVQRLELDFSESKTEGHELHTFSPYFKTTSSFSSLVSLRLIDVDIPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSNLEINAPNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLMAVSVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query285 2.2.26 [Sep-21-2011]
Q9FX89385 Putative F-box protein At yes no 0.768 0.568 0.273 2e-12
Q9FGQ3 444 F-box/FBD/LRR-repeat prot yes no 0.705 0.452 0.282 2e-11
Q9FM94 421 FBD-associated F-box prot no no 0.785 0.532 0.264 1e-10
Q9LZ15 456 Putative F-box/LRR-repeat no no 0.621 0.388 0.297 2e-10
Q84W80 481 F-box/LRR-repeat protein no no 0.775 0.459 0.269 2e-10
Q9LXR6 457 Putative F-box protein At no no 0.757 0.472 0.289 4e-10
Q9FZ70 416 F-box/FBD/LRR-repeat prot no no 0.698 0.478 0.316 5e-10
Q9FFU7 472 Putative F-box/LRR-repeat no no 0.873 0.527 0.282 6e-10
Q9LXJ7 416 FBD-associated F-box prot no no 0.768 0.526 0.264 2e-09
Q9SAG4 486 F-box protein At1g80960 O no no 0.726 0.425 0.281 2e-09
>sp|Q9FX89|FB50_ARATH Putative F-box protein At1g49610 OS=Arabidopsis thaliana GN=At1g49610 PE=4 SV=2 Back     alignment and function desciption
 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 122/274 (44%), Gaps = 55/274 (20%)

Query: 3   DRISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSD 62
           D IS LPD IL   LS +  + A R S+LS RWR++W   T SLDF D YK+        
Sbjct: 26  DSISSLPDVILQENLSLIPTKFAIRTSVLSKRWRHVWS-ETPSLDFDDCYKLD------- 77

Query: 63  PYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQ--QLRICYPVNSDYDVDSWVQFAVD 120
                             ++ +D  L L + + +    L I   +N  Y +D W++FA+ 
Sbjct: 78  ------------------VDFIDKTLALYRARKIMTFDLWITNGINLPY-IDGWIKFAMS 118

Query: 121 KRVQRLELDFS----------------ESKTEGHELHTFSPYFKTTSSFSSLVSLRLIDV 164
           + V+ L L F                 +    G E    +P  + + S+SSL  L L   
Sbjct: 119 RNVENLFLSFDFRLYDVPDYLYINSSVKQLVLGTESSELNP--RCSVSWSSLTKLSLFS- 175

Query: 165 DIPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVS-GPSLKLKYLELRD-LPNLSNLEINA 222
              +E +  +L  CP++E LTL   ++L+ + ++  PSLK+  LE+   +       I A
Sbjct: 176 ---DESIAKILSGCPIIESLTLHFCDQLMVLDLTKSPSLKI--LEIHGSIWGSGPKHIVA 230

Query: 223 PNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCT 256
           P++ S      +  + F  + SL E  ++  +C+
Sbjct: 231 PHIHSLTLKTSQFFIYFCDISSLTEAKVDICFCS 264





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FGQ3|FDL37_ARATH F-box/FBD/LRR-repeat protein At5g53840 OS=Arabidopsis thaliana GN=At5g53840 PE=2 SV=1 Back     alignment and function description
>sp|Q9FM94|FBD21_ARATH FBD-associated F-box protein At5g56370 OS=Arabidopsis thaliana GN=At5g56370 PE=2 SV=1 Back     alignment and function description
>sp|Q9LZ15|FBL78_ARATH Putative F-box/LRR-repeat protein At5g02700 OS=Arabidopsis thaliana GN=At5g02700 PE=4 SV=1 Back     alignment and function description
>sp|Q84W80|FBL42_ARATH F-box/LRR-repeat protein At3g03360 OS=Arabidopsis thaliana GN=At3g03360 PE=2 SV=2 Back     alignment and function description
>sp|Q9LXR6|FB207_ARATH Putative F-box protein At3g58860 OS=Arabidopsis thaliana GN=At3g58860 PE=4 SV=1 Back     alignment and function description
>sp|Q9FZ70|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570 OS=Arabidopsis thaliana GN=At1g13570 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFU7|FBL90_ARATH Putative F-box/LRR-repeat protein At5g54820 OS=Arabidopsis thaliana GN=At5g54820 PE=4 SV=1 Back     alignment and function description
>sp|Q9LXJ7|FBD11_ARATH FBD-associated F-box protein At3g52670 OS=Arabidopsis thaliana GN=At3g52670 PE=1 SV=2 Back     alignment and function description
>sp|Q9SAG4|FB93_ARATH F-box protein At1g80960 OS=Arabidopsis thaliana GN=At1g80960 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
255544812 464 ubiquitin-protein ligase, putative [Rici 0.947 0.581 0.409 4e-49
357477131 447 F-box family-6 [Medicago truncatula] gi| 0.950 0.606 0.367 2e-40
356544606 444 PREDICTED: putative F-box protein At3g58 0.915 0.587 0.381 2e-39
449440973 475 PREDICTED: putative FBD-associated F-box 0.933 0.56 0.355 6e-30
302142991 402 unnamed protein product [Vitis vinifera] 0.954 0.676 0.326 2e-29
255540581 457 ubiquitin-protein ligase, putative [Rici 0.782 0.487 0.383 1e-27
297736820 487 unnamed protein product [Vitis vinifera] 0.961 0.562 0.268 1e-20
147865783 1789 hypothetical protein VITISV_020815 [Viti 0.961 0.153 0.275 3e-20
357155585 449 PREDICTED: LOW QUALITY PROTEIN: putative 0.8 0.507 0.283 3e-15
242047392256 hypothetical protein SORBIDRAFT_02g00277 0.670 0.746 0.323 3e-15
>gi|255544812|ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  201 bits (510), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 181/286 (63%), Gaps = 16/286 (5%)

Query: 1   MDDRISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAIL 60
           + + IS+LP+D+L+ ILSRLT++EAAR SILS RWR+LW ++TG +DF     +  L + 
Sbjct: 31  ISEHISQLPEDVLLNILSRLTMKEAARTSILSTRWRHLWTYYTGIMDFDASLTMWYLQL- 89

Query: 61  SDPYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSD--YDVDSWVQFA 118
                    +  + ++R +F++ V+ +L   +  +++ LRIC+ ++SD  Y++DSW+  A
Sbjct: 90  ------GLGSKSLDMERHSFVSWVNQVLRSHEGPTMEGLRICFDLDSDFMYEIDSWITIA 143

Query: 119 VDKRVQRLELDFSES----KTEGHELHTFSPYFKTTSSFSSLVSLRLIDVDIPEEVL-HY 173
           + KRV+RLE+D +      KT G   + F       SSFSSL +L+L  VD+  E L H 
Sbjct: 144 MQKRVKRLEIDLTNIEPSIKTTGS--YAFPSGLLNDSSFSSLKTLQLNMVDVTGEALQHL 201

Query: 174 LLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSNLEINAPNLVSFEFSAG 233
           LL +CPLLEVL++  +  L+ ++VSG SLKLKYLE+    NL  LEI A +LVSF++   
Sbjct: 202 LLSWCPLLEVLSIVNSTSLVSLKVSGSSLKLKYLEMVCCNNLKYLEITAASLVSFKYYGP 261

Query: 234 ELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNL 279
            + + FK VP+LV+ S  G +C   +  L+QFS ++ QL TL+ ++
Sbjct: 262 LIGLPFKSVPNLVDASFGGPFCQLTIENLYQFSLYILQLETLRFDV 307




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357477131|ref|XP_003608851.1| F-box family-6 [Medicago truncatula] gi|355509906|gb|AES91048.1| F-box family-6 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356544606|ref|XP_003540740.1| PREDICTED: putative F-box protein At3g58860-like [Glycine max] Back     alignment and taxonomy information
>gi|449440973|ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] gi|449501454|ref|XP_004161371.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|302142991|emb|CBI20286.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255540581|ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297736820|emb|CBI26021.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865783|emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357155585|ref|XP_003577168.1| PREDICTED: LOW QUALITY PROTEIN: putative F-box/LRR-repeat protein At5g54820-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|242047392|ref|XP_002461442.1| hypothetical protein SORBIDRAFT_02g002773 [Sorghum bicolor] gi|241924819|gb|EER97963.1| hypothetical protein SORBIDRAFT_02g002773 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
TAIR|locus:2160205 472 AT5G54820 [Arabidopsis thalian 0.887 0.536 0.282 3e-12
TAIR|locus:2010032 416 AT1G13570 "AT1G13570" [Arabido 0.715 0.490 0.314 3.1e-11
TAIR|locus:2161088 421 AT5G56370 "AT5G56370" [Arabido 0.133 0.090 0.552 1.3e-10
TAIR|locus:2099019 457 AT3G58860 "AT3G58860" [Arabido 0.810 0.505 0.306 1.5e-10
TAIR|locus:2099644 481 AT3G03360 [Arabidopsis thalian 0.835 0.494 0.271 1.5e-09
TAIR|locus:2037558 452 AT1G78760 "AT1G78760" [Arabido 0.554 0.349 0.254 4.6e-09
TAIR|locus:2129266 434 AT4G13960 "AT4G13960" [Arabido 0.403 0.264 0.354 5.5e-09
TAIR|locus:2025812 486 AT1G80960 "AT1G80960" [Arabido 0.740 0.434 0.265 7.6e-09
TAIR|locus:2081157 520 AT3G59200 "AT3G59200" [Arabido 0.743 0.407 0.311 1.5e-08
TAIR|locus:2151261 469 AT5G02930 "AT5G02930" [Arabido 0.870 0.528 0.278 3.5e-08
TAIR|locus:2160205 AT5G54820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 186 (70.5 bits), Expect = 3.0e-12, P = 3.0e-12
 Identities = 82/290 (28%), Positives = 135/290 (46%)

Query:     3 DRISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSD 62
             DR+S LPD +LI I+S L ++E  R S+LS RWRYL    T +L F +   +     ++D
Sbjct:     7 DRLSSLPDILLIMIISFLPLKECVRTSVLSKRWRYLC-LETTNLSFKESDYVN--PDITD 63

Query:    63 PYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYP--VNSDYDVDSWVQFAVD 120
               Y     Y      R+F   VD  + + Q + ++   IC+   V  +  +D+ +++AV 
Sbjct:    64 AEYSRIVAY------RSFFCSVDKWVSITQHQVVESFEICFSHLVGFEDKIDALIEYAVS 117

Query:   121 KRVQRLELDFSES--KTEG-----HELHTF--SPYFKTT-------------SSFSSLVS 158
              RV+ L +D S    ++ G     H ++T   S Y  TT             S F + V 
Sbjct:   118 TRVKNLVVDLSNPSWRSNGDISYRHFMYTLPKSVYSLTTLESLKIYGCKFDPSKFVNPVL 177

Query:   159 LRLIDVD-IPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSN 217
             LR + +  +  E LH LL   P L+ L++K    +    ++G   +L  +E  D   +  
Sbjct:   178 LRSLSIGWVRLENLHSLLSKSPSLQSLSIKNCWGVDITSMAGQFREL-VIEHSDFSYMQ- 235

Query:   218 LEINAPNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSS 267
                  P + SF++S GEL   +  V +++  ++  D+    VY L   SS
Sbjct:   236 CAFELPRIHSFKYS-GELFEFYFDVVNVIIPNVYLDFGEERVYDLQSQSS 284




GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2010032 AT1G13570 "AT1G13570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161088 AT5G56370 "AT5G56370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099019 AT3G58860 "AT3G58860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099644 AT3G03360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037558 AT1G78760 "AT1G78760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129266 AT4G13960 "AT4G13960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025812 AT1G80960 "AT1G80960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081157 AT3G59200 "AT3G59200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151261 AT5G02930 "AT5G02930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
Sb02g002773.1
hypothetical protein (256 aa)
(Sorghum bicolor)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
pfam0064648 pfam00646, F-box, F-box domain 3e-04
pfam1293747 pfam12937, F-box-like, F-box-like 4e-04
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
 Score = 37.6 bits (88), Expect = 3e-04
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 3  DRISKLPDDILICILSRLTIEEAARASILSYRWRYLWR 40
            +  LPDD+L+ ILSRL  ++  R S++S RWR L  
Sbjct: 1  FSLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVD 38


This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48

>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 285
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.55
KOG4341 483 consensus F-box protein containing LRR [General fu 99.41
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 99.01
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.57
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.46
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 98.15
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.92
KOG4341483 consensus F-box protein containing LRR [General fu 97.75
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.54
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 97.49
KOG1947 482 consensus Leucine rich repeat proteins, some prote 97.49
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.34
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.32
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.27
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.27
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.26
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.24
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.2
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.03
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 96.95
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.89
KOG0281 499 consensus Beta-TrCP (transducin repeats containing 96.48
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.4
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 95.93
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 95.72
KOG2997366 consensus F-box protein FBX9 [General function pre 95.18
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.04
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 94.65
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 94.63
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 94.53
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.51
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 94.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 94.41
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.28
PRK15386 426 type III secretion protein GogB; Provisional 93.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 93.48
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 92.93
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 92.3
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 90.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 90.62
PF13013109 F-box-like_2: F-box-like domain 89.99
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 84.64
KOG2982 418 consensus Uncharacterized conserved protein [Funct 84.32
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 84.29
KOG2982 418 consensus Uncharacterized conserved protein [Funct 82.7
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 82.22
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 81.59
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 81.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 81.06
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.55  E-value=1.5e-16  Score=129.92  Aligned_cols=249  Identities=24%  Similarity=0.256  Sum_probs=147.1

Q ss_pred             CCCCChHHHHHHHhcCChhhHhhhcccccchhh------hccccCCceeecCccchhcccc--cCCCcccccchhhhhhh
Q 023212            5 ISKLPDDILICILSRLTIEEAARASILSYRWRY------LWRFFTGSLDFVDPYKIRRLAI--LSDPYYKCEDNYFIRVK   76 (285)
Q Consensus         5 is~LPd~iL~~Ils~L~~~d~~~~s~vs~rW~~------lw~~~~~~l~f~~~~~~~~~~~--~~~~~~~~~~~~~~~~~   76 (285)
                      +..|||||+..||+.|+-+|+.+++.|||||++      +|.    .++..+..+.|..-.  ..+-.      ..++..
T Consensus        98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~----~lDl~~r~i~p~~l~~l~~rgV------~v~Rla  167 (419)
T KOG2120|consen   98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQ----TLDLTGRNIHPDVLGRLLSRGV------IVFRLA  167 (419)
T ss_pred             cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhcccccccee----eeccCCCccChhHHHHHHhCCe------EEEEcc
Confidence            468999999999999999999999999999986      577    666666644432100  00000      000000


Q ss_pred             --hhhHHHhHHHHHhccCCCCCceEEEEeeCCCcccHHHHHHHHHh-CCceEEEEEecCCCCCCCceeecCcccc-CCCC
Q 023212           77 --RRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFAVD-KRVQRLELDFSESKTEGHELHTFSPYFK-TTSS  152 (285)
Q Consensus        77 --~~~~~~~v~~~L~~~~~~~l~~l~l~~~~~~~~~~~~wl~~~~~-~~v~~L~l~~~~~~~~~~~~~~~p~~~~-~~~~  152 (285)
                        ..+-.+++..+.-.+  .+++.+.++-...   .+......... ..++.+.+....          +..... ..+.
T Consensus       168 r~~~~~prlae~~~~fr--sRlq~lDLS~s~i---t~stl~~iLs~C~kLk~lSlEg~~----------LdD~I~~~iAk  232 (419)
T KOG2120|consen  168 RSFMDQPRLAEHFSPFR--SRLQHLDLSNSVI---TVSTLHGILSQCSKLKNLSLEGLR----------LDDPIVNTIAK  232 (419)
T ss_pred             hhhhcCchhhhhhhhhh--hhhHHhhcchhhe---eHHHHHHHHHHHHhhhhccccccc----------cCcHHHHHHhc
Confidence              000001111111000  1233444432221   11222222222 244445444221          111110 1123


Q ss_pred             CCCccEEEeeeEE-eChhHHHHHHhcCCccceeecccCCCcce---EEEeCCCCceeEEEEecCCC-C-----CeEEEeC
Q 023212          153 FSSLVSLRLIDVD-IPEEVLHYLLCYCPLLEVLTLKGAEKLIR---IRVSGPSLKLKYLELRDLPN-L-----SNLEINA  222 (285)
Q Consensus       153 ~~~L~~L~L~~~~-i~~~~l~~ll~~cp~Le~L~L~~c~~~~~---~~i~~~~~~L~~L~i~~c~~-l-----~~l~i~~  222 (285)
                      =.+|+.|+|+.+. |+..++.-+++.|..|.+|+|.+|...++   ..|.+-++++..|.++||.. +     ..+...|
T Consensus       233 N~~L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~~sh~~tL~~rc  312 (419)
T KOG2120|consen  233 NSNLVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQKSHLSTLVRRC  312 (419)
T ss_pred             cccceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhhhhHHHHHHHhC
Confidence            3689999999988 99999999999999999999999976554   35566778899999999853 2     2233478


Q ss_pred             CCceEEEEeccee-----eeeecCCCceEEEEEEccccchhhhHHhhhhcCCCcceEEEEEEE
Q 023212          223 PNLVSFEFSAGEL-----IVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLM  280 (285)
Q Consensus       223 p~L~~l~~~~~~~-----~~~~~~~~~L~~l~l~~~~~~~~~~~~~~ll~~~~~L~~L~L~~~  280 (285)
                      |+|..|+++++..     ...+-..+.|+.+.++.+. ... ....-.+...|.|..|++..+
T Consensus       313 p~l~~LDLSD~v~l~~~~~~~~~kf~~L~~lSlsRCY-~i~-p~~~~~l~s~psl~yLdv~g~  373 (419)
T KOG2120|consen  313 PNLVHLDLSDSVMLKNDCFQEFFKFNYLQHLSLSRCY-DII-PETLLELNSKPSLVYLDVFGC  373 (419)
T ss_pred             CceeeeccccccccCchHHHHHHhcchheeeehhhhc-CCC-hHHeeeeccCcceEEEEeccc
Confidence            9999999987653     1234467899999998633 222 233333578888888887643



>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 9e-05
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 1e-04
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
 Score = 51.4 bits (123), Expect = 1e-07
 Identities = 48/240 (20%), Positives = 76/240 (31%), Gaps = 39/240 (16%)

Query: 5   ISKLPDDILICILSRLTIEEAARASILSYRWR------YLWRFFTGSLDFVDPYKIRRLA 58
              LPD++L+ I S L + E  + S +  RW        LW+    +   + P    RL 
Sbjct: 9   WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLL 68

Query: 59  ILSDPYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFA 118
                         +   R     +  P+        +Q + +   V     +   +   
Sbjct: 69  SQG-----------VIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQC 117

Query: 119 VDKRVQRLELDFSESKTEGHELHTFSPYFKTTSSFSSLVSLRLIDVD-IPEEVLHYLLCY 177
              ++Q L L+                   T +  S+LV L L       E  L  LL  
Sbjct: 118 --SKLQNLSLEGLRLSDPI---------VNTLAKNSNLVRLNLSGCSGFSEFALQTLLSS 166

Query: 178 CPLLEVLTLKGAEKL----IRIRVSGPSLKLKYLELRDLPN------LSNLEINAPNLVS 227
           C  L+ L L          +++ V+  S  +  L L           LS L    PNLV 
Sbjct: 167 CSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVH 226


>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.74
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.69
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.01
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.46
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.34
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.34
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.31
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.17
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.16
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 98.1
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.99
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.98
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.95
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.89
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.87
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.87
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.86
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.79
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.78
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.75
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.74
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.73
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.72
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.7
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.67
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.66
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.66
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.63
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.61
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.59
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.59
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.58
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.57
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.51
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.5
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.49
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.49
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.49
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.49
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.49
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 97.48
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.48
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.47
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 97.44
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.41
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.39
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.39
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.38
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.38
1o6v_A466 Internalin A; bacterial infection, extracellular r 97.38
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.37
1o6v_A 466 Internalin A; bacterial infection, extracellular r 97.37
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.36
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.34
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.34
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.33
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.31
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.29
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.27
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.23
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.22
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.2
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 97.2
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.19
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.17
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.17
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.15
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.09
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.07
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 97.05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.03
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.02
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.02
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.0
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.0
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 96.96
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 96.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.96
3m19_A251 Variable lymphocyte receptor A diversity region; a 96.93
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 96.91
3e6j_A229 Variable lymphocyte receptor diversity region; var 96.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 96.83
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 96.82
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 96.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 96.72
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 96.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.68
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 96.68
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 96.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 96.59
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.55
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 96.5
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 96.46
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 96.36
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 96.26
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.23
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 96.13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 95.77
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 95.71
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 95.67
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 95.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 95.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 95.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 95.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 95.15
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 95.13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 95.12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 95.08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 95.05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 94.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 94.46
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 93.89
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 93.78
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 93.73
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 93.36
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 93.13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 92.84
4fdw_A401 Leucine rich hypothetical protein; putative cell s 92.62
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 92.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 89.69
4gt6_A394 Cell surface protein; leucine rich repeats, putati 87.25
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 86.24
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 84.86
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 84.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 83.84
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 83.19
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 80.62
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
Probab=99.78  E-value=4.5e-19  Score=164.08  Aligned_cols=151  Identities=13%  Similarity=0.206  Sum_probs=90.3

Q ss_pred             CCcCCCCChHHHHHHHhcCC-hhhHhhhcccccchhhhccccCCceeecCccchhcccccCCCcccccchhhhhhhhhhH
Q 023212            2 DDRISKLPDDILICILSRLT-IEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSDPYYKCEDNYFIRVKRRNF   80 (285)
Q Consensus         2 ~D~is~LPd~iL~~Ils~L~-~~d~~~~s~vs~rW~~lw~~~~~~l~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (285)
                      +|+++.||||||.+||+||+ .+|+++++.|||||+++.......+++...+..                          
T Consensus         3 ~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~--------------------------   56 (594)
T 2p1m_B            3 KRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAV--------------------------   56 (594)
T ss_dssp             -------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSS--------------------------
T ss_pred             ccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeecccccc--------------------------
Confidence            49999999999999999999 999999999999999873312334444332100                          


Q ss_pred             HHhHHHHHhccCCCCCceEEEEeeCCC----------cccHHHHHHHHHh--CCceEEEEEecCCCCCCCceeecCcccc
Q 023212           81 INLVDPILGLLQTKSLQQLRICYPVNS----------DYDVDSWVQFAVD--KRVQRLELDFSESKTEGHELHTFSPYFK  148 (285)
Q Consensus        81 ~~~v~~~L~~~~~~~l~~l~l~~~~~~----------~~~~~~wl~~~~~--~~v~~L~l~~~~~~~~~~~~~~~p~~~~  148 (285)
                        .....+...  +.++++.+......          ...+..|+.....  +++++|.+..+.-.      ...+..+ 
T Consensus        57 --~~~~~~~~~--~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~------~~~~~~l-  125 (594)
T 2p1m_B           57 --SPATVIRRF--PKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVT------DDCLELI-  125 (594)
T ss_dssp             --CHHHHHHHC--TTCCEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCC------HHHHHHH-
T ss_pred             --CHHHHHhhC--CCceEEeccCCCchhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEc------HHHHHHH-
Confidence              001122222  24777887764311          0345567776654  68888888744211      0000111 


Q ss_pred             CCCCCCCccEEEeeeE-EeChhHHHHHHhcCCccceeecccCC
Q 023212          149 TTSSFSSLVSLRLIDV-DIPEEVLHYLLCYCPLLEVLTLKGAE  190 (285)
Q Consensus       149 ~~~~~~~L~~L~L~~~-~i~~~~l~~ll~~cp~Le~L~L~~c~  190 (285)
                       ...|++|++|+|.++ .+++.++..+..+||+|++|+|.+|.
T Consensus       126 -~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~  167 (594)
T 2p1m_B          126 -AKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESD  167 (594)
T ss_dssp             -HHHCTTCCEEEEESCEEEEHHHHHHHHHHCTTCCEEECTTCE
T ss_pred             -HHhCCCCcEEeCCCcCCCCHHHHHHHHHhCCCCCEEeCcCCc
Confidence             013678888888877 47777777777788888888887764



>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 285
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 1e-06
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 1e-05
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 6e-04
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Cdc4 F-box and linker domains
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 43.9 bits (103), Expect = 1e-06
 Identities = 21/90 (23%), Positives = 33/90 (36%), Gaps = 10/90 (11%)

Query: 3  DRISKLPDDILICILSRLTIEEAARASILSYRWRY-------LWRFFTGSLDFVDPYKIR 55
          D I+ LP +I + I + L  E+   +  +S  W         LW+    S +FV P    
Sbjct: 4  DLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWKKLLISENFVSPKGFN 63

Query: 56 RLAILSDPYYK---CEDNYFIRVKRRNFIN 82
           L +     Y     +D   +      FI 
Sbjct: 64 SLNLKLSQKYPKLSQQDRLRLSFLENIFIL 93


>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.98
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.93
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.8
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.79
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.08
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.57
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.31
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.08
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.07
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.01
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 96.95
d1p9ag_266 von Willebrand factor binding domain of glycoprote 96.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.79
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 96.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.52
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.38
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.95
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 95.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 95.4
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 95.13
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 95.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 94.92
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 94.62
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 94.51
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 94.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 94.05
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 93.82
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 92.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 89.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 89.71
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 88.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 87.96
d2ifga3156 High affinity nerve growth factor receptor, N-term 86.43
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 85.06
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 84.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 83.68
d2ifga3156 High affinity nerve growth factor receptor, N-term 83.21
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.26  E-value=1.3e-12  Score=74.21  Aligned_cols=36  Identities=33%  Similarity=0.503  Sum_probs=33.5

Q ss_pred             CCCCChHHHHHHHhcCChhhHhhhcccccchhhhcc
Q 023212            5 ISKLPDDILICILSRLTIEEAARASILSYRWRYLWR   40 (285)
Q Consensus         5 is~LPd~iL~~Ils~L~~~d~~~~s~vs~rW~~lw~   40 (285)
                      ++.||+||+.+||+||+.+|+++++.|||+|+++-.
T Consensus         1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~   36 (41)
T d1fs1a1           1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLAS   36 (41)
T ss_dssp             CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHT
T ss_pred             CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhC
Confidence            478999999999999999999999999999998754



>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure