BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023222
         (285 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2L16|A Chain A, Solution Structure Of Bacillus Subtilits Tatad Protein In
           Dpc Micelles
          Length = 78

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%)

Query: 125 VGAPEALVIGVVALLVFGPKGLAEVARNLGKTLRAFQPTIREL 167
           +G P  ++I V+AL++FGP  L E+ R  G+TL  F+   + L
Sbjct: 5   IGIPGLILIFVIALIIFGPSKLPEIGRAAGRTLLEFKSATKSL 47


>pdb|3GAA|A Chain A, The Crystal Structure Of The Protein With Unknown Function
           From Thermoplasma Acidophilum
 pdb|3GAA|B Chain B, The Crystal Structure Of The Protein With Unknown Function
           From Thermoplasma Acidophilum
 pdb|3GAA|C Chain C, The Crystal Structure Of The Protein With Unknown Function
           From Thermoplasma Acidophilum
 pdb|3GAA|D Chain D, The Crystal Structure Of The Protein With Unknown Function
           From Thermoplasma Acidophilum
 pdb|3GAA|E Chain E, The Crystal Structure Of The Protein With Unknown Function
           From Thermoplasma Acidophilum
          Length = 252

 Score = 27.7 bits (60), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 4/63 (6%)

Query: 212 TEDSQTVADPNGAASA----NKAYTSEEYLKMTEEQLKASAAHQQEQSPQGESLSEPQTQ 267
           T  S  + DP    S     NKAY  +    + EEQ+KA     ++   Q + L E Q +
Sbjct: 187 TPTSVDIPDPGAVLSIIEAINKAYNLKIKTDLLEEQVKALDEQIKKIEEQYKELQEKQKE 246

Query: 268 PQA 270
           PQ+
Sbjct: 247 PQS 249


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.126    0.347 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,909,888
Number of Sequences: 62578
Number of extensions: 233314
Number of successful extensions: 424
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 420
Number of HSP's gapped (non-prelim): 6
length of query: 285
length of database: 14,973,337
effective HSP length: 98
effective length of query: 187
effective length of database: 8,840,693
effective search space: 1653209591
effective search space used: 1653209591
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 51 (24.3 bits)