BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023235
         (285 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MCM|A Chain A, Crystal Structure Of The 6-Hyroxymethyl-7,8-Dihydropterin
           Pyrophosphokinase Dihydropteroate Synthase Bifunctional
           Enzyme From Francisella Tularensis
 pdb|3MCM|B Chain B, Crystal Structure Of The 6-Hyroxymethyl-7,8-Dihydropterin
           Pyrophosphokinase Dihydropteroate Synthase Bifunctional
           Enzyme From Francisella Tularensis
 pdb|3MCN|A Chain A, Crystal Structure Of The 6-Hyroxymethyl-7,8-Dihydropterin
           Pyrophosphokinase Dihydropteroate Synthase Bifunctional
           Enzyme From Francisella Tularensis
 pdb|3MCN|B Chain B, Crystal Structure Of The 6-Hyroxymethyl-7,8-Dihydropterin
           Pyrophosphokinase Dihydropteroate Synthase Bifunctional
           Enzyme From Francisella Tularensis
 pdb|3MCO|A Chain A, Crystal Structure Of The 6-Hyroxymethyl-7,8-Dihydropterin
           Pyrophosphokinase Dihydropteroate Synthase Bifunctional
           Enzyme From Francisella Tularensis
 pdb|3MCO|B Chain B, Crystal Structure Of The 6-Hyroxymethyl-7,8-Dihydropterin
           Pyrophosphokinase Dihydropteroate Synthase Bifunctional
           Enzyme From Francisella Tularensis
          Length = 442

 Score = 33.1 bits (74), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%)

Query: 232 CCKRRPPLDARKGKMNMCDYIRQRVSLLLKFSKQRLNAYSDLYFS 276
              R   LD      N+CDYI Q+  +LLK    + N Y D+ F 
Sbjct: 326 ITDRNQYLDKENAIDNVCDYIEQKKQILLKHGIAQQNIYFDIGFG 370


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.140    0.442 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,790,518
Number of Sequences: 62578
Number of extensions: 284449
Number of successful extensions: 589
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 588
Number of HSP's gapped (non-prelim): 1
length of query: 285
length of database: 14,973,337
effective HSP length: 98
effective length of query: 187
effective length of database: 8,840,693
effective search space: 1653209591
effective search space used: 1653209591
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)