Citrus Sinensis ID: 023237

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----

MGQALGCIQVDQSTVAIKETFGKFDDVLEPGCHCLPWCLGSQVAGQLSLRVQQLDVRCETKTKDNVFVNVVASVQYRALAEKASDAFYKLSNTRSQIQAYVFDVIRASVPKLDLDATFEQKNDIAKAVEEELEKAMSHYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRLAANEKAEAEKILQIKRAEGEAESKYLAGLGIARQRQAIVDGLRDSVLAFSENVPGTSSKDVMDMVLVTQYFDTMKEIGASSKTNSVFIPHGPGAVKDIASQIREGLLQANATT

ccccEEEEEEccccEEEEEcccccccccccccCEEccccccccccccccEEEEcccccccccccccEEEEcEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHHcccc

***ALGCIQVDQSTVAIKETFGKFDDVLEPGCHCLPWCLGSQVAGQLSLRVQQLDVRCETKTKDNVFVNVVASVQYRALAEKASDAFYKLSNTRSQIQAYVFDVIRASVPKLDLDATFEQKNDIAKAVEEELEKAMSHYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRLAANEKAEAEKILQIKRAEGEAESKYLAGLGIARQRQAIVDGLRDSVLAFSENVPGTSSKDVMDMVLVTQYFDTMKEIGASSKTNSVFIPHGPGAVKDIASQI****L******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGQALGCIQVDQSTVAIKETFGKFDDVLEPGCHCLPWCLGSQVAGQLSLRVQQLDVRCETKTKDNVFVNVVASVQYRALAEKASDAFYKLSNTRSQIQAYVFDVIRASVPKLDLDATFEQKNDIAKAVEEELEKAMSHYGYEIVQTLIVDIEPDEHVKRAMNEINAAARxxxxxxxxxxxxxxxxxxxxxGEAESKYLAGLGIARQRQAIVDGLRDSVLAFSENVPGTSSKDVMDMVLVTQYFDTMKEIGASSKTNSVFIPHGPGAVKDIASQIREGLLQANATT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Hypersensitive-induced response protein 2		confident	Q9CAR7
Hypersensitive-induced response protein 1		probable	Q9FM19
Hypersensitive-induced response protein 3		probable	Q9SRH6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BK6, chain A
Confidence level:very confident
Coverage over the Query: 41-181,193-202,218-224,235-245
View the alignment between query and template
View the model in PyMOL

Template: 2ZUO, chain A
Confidence level:confident
Coverage over the Query: 7-162
View the alignment between query and template
View the model in PyMOL