BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023248
         (285 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1IRZ|A Chain A, Solution Structure Of Arr10-B Belonging To The Garp
          Family Of Plant Myb-Related Dna Binding Motifs Of The
          Arabidopsis Response Regulators
          Length = 64

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 40/60 (66%), Gaps = 1/60 (1%)

Query: 18 TRDPKPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRLG 77
          T   KPR+ WT +LH++F+ AV  LG  ++A PK +L LM +  LT  ++ SHLQK+R+ 
Sbjct: 1  TAQKKPRVLWTHELHNKFLAAVDHLG-VERAVPKKILDLMNVDKLTRENVASHLQKFRVA 59


>pdb|2DR1|A Chain A, Crystal Structure Of The Ph1308 Protein From Pyrococcus
           Horikoshii Ot3
 pdb|2DR1|B Chain B, Crystal Structure Of The Ph1308 Protein From Pyrococcus
           Horikoshii Ot3
          Length = 386

 Score = 28.1 bits (61), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 2/29 (6%)

Query: 20  DPKPRLRWTADLHDR--FVDAVTKLGGPD 46
           +P P L   A  HD+  FVDAV+ +GG D
Sbjct: 163 NPLPELAKVAKEHDKLVFVDAVSAMGGAD 191


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.130    0.370 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,197,687
Number of Sequences: 62578
Number of extensions: 327332
Number of successful extensions: 567
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 565
Number of HSP's gapped (non-prelim): 5
length of query: 285
length of database: 14,973,337
effective HSP length: 98
effective length of query: 187
effective length of database: 8,840,693
effective search space: 1653209591
effective search space used: 1653209591
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 51 (24.3 bits)