BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023260
         (285 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1RM1|A Chain A, Structure Of A Yeast TfiiaTBPTATA-Box Dna Complex
          Length = 240

 Score = 31.6 bits (70), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 8/78 (10%)

Query: 43  QRELLWFQAVKKVV----PRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCM 98
           +  L  F+   K+V     R++ E +N+ G  P   F  +  D+K    +  KDT+++  
Sbjct: 4   EERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEE-DIKRAAPESEKDTSATSG 62

Query: 99  IVATL---IATVVFAAAL 113
           IV TL   +ATV     L
Sbjct: 63  IVPTLQNIVATVTLGCRL 80


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.138    0.403 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,473,607
Number of Sequences: 62578
Number of extensions: 269207
Number of successful extensions: 755
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 754
Number of HSP's gapped (non-prelim): 3
length of query: 285
length of database: 14,973,337
effective HSP length: 98
effective length of query: 187
effective length of database: 8,840,693
effective search space: 1653209591
effective search space used: 1653209591
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)