BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023264
(285 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2J66|A Chain A, Structural Characterisation Of Btrk Decarboxylase From
Butirosin Biosynthesis
Length = 428
Score = 28.5 bits (62), Expect = 4.9, Method: Compositional matrix adjust.
Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 13/68 (19%)
Query: 29 NNAISCVKGRDYSSSFPVRYVPKKSVKIKESENSVPVKGLERNELRKQPDASGLRTEVSN 88
++A S +GR S++P+ Y+P ++E R EL K A L T
Sbjct: 305 HHAASTFRGRSMRSNYPMEYIP-----VREDSG--------RRELEKVTIAGPLCTPEDC 351
Query: 89 SGRDVKKP 96
G+DV P
Sbjct: 352 LGKDVHVP 359
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.130 0.362
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,667,031
Number of Sequences: 62578
Number of extensions: 230857
Number of successful extensions: 371
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 370
Number of HSP's gapped (non-prelim): 2
length of query: 285
length of database: 14,973,337
effective HSP length: 98
effective length of query: 187
effective length of database: 8,840,693
effective search space: 1653209591
effective search space used: 1653209591
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 51 (24.3 bits)