Citrus Sinensis ID: 023268

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
MSAMLKEQLVKVFSLMKPGMLFQYEPELDAFLEFLIWRFSIWVDKPTPGNALMNLRYRDERAVETRAKVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSKDKSSSSEEDVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGVINPKISSQ
cHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccHHHHcccEEcccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccEECccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccc
MSAMLKEQLVKVFSLMKPGMLFQYEPELDAFLEFLIWRFSIWVDKPTPGNALMNLRYRDERAVETR*KVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSK********DVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGV********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAMLKEQLVKVFSLMKPGMLFQYEPELDAFLEFLIWRFSIWVDKPTPGNALMNLRYRDERAVETRAKVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSKDKSSSSEEDVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGVINPKISSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisome biogenesis protein 2 Might act directly in a photomorphogenetic pathway negatively regulated by DET1, which is involved in peroxisome assembly and matrix protein import. Could be part of a complex responsible for the monoubiquitination of PEX5.confidentQ9CA86
Peroxisome biogenesis factor 2 Somewhat implicated in the biogenesis of peroxisomes.probableP28328
Peroxisome biogenesis factor 2 Somewhat implicated in the biogenesis of peroxisomes.probableQ06438

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CHC, chain A
Confidence level:very confident
Coverage over the Query: 219-271
View the alignment between query and template
View the model in PyMOL
Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 212-283
View the alignment between query and template
View the model in PyMOL