Citrus Sinensis ID: 023270

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
MDTKTAEREDNRKREWSLQDFEIGRPLGKGKFGRVYLVREVESKHPVALKIIFKEQIEKYKIQHQLRREMEIQSSLRHPNILRLYGWFHDDERIFLILEYAHRGELYRELRKHRRFTEQQAATYIASLTNALAYCHENHVIHRDIKPENLLLDHEGRLKIGDFGWSVQSRSKRHTMCGTLDYLAPEMVENKEHDYAVDNWTLGILCYEFLYGAPPFEAESQKDTFRRIMKVDLSFPSAPSISAEAKHLISRLLVKDSSKRLSLQKIMEHPWIIKNANPRGTCDI
cccccccccccccccCEEccccccccccccccccEEEEEEEccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHccccccECccccEEECccEEEEEEEEccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEECccccEEcccccccccccccccccEEcccccccccHHEHHHHHHHHHHHccccccccccHHHHHHHHHcccCCccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccc
*****************LQDFEIGRPLGKGKFGRVYLVREVESKHPVALKIIFKEQIEKYKIQHQLRREMEIQSSLRHPNILRLYGWFHDDERIFLILEYAHRGELYRELRKHRRFTEQQAATYIASLTNALAYCHENHVIHRDIKPENLLLDHEGRLKIGDFGWSVQSRSKRHTMCGTLDYLAPEMVENKEHDYAVDNWTLGILCYEFLYGAPPFEAESQKDTFRRIMKVDLSFPSAPSISAEAKHLISRLLVKDSSKRLSLQKIMEHPWIIKNANP******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTKTAEREDNRKREWSLQDFEIGRPLGKGKFGRVYLVREVESKHPVALKIIFKEQIEKYKIQHQLRREMEIQSSLRHPNILRLYGWFHDDERIFLILEYAHRGELYRELRKHRRFTEQQAATYIASLTNALAYCHENHVIHRDIKPENLLLDHEGRLKIGDFGWSVQSRSKRHTMCGTLDYLAPEMVENKEHDYAVDNWTLGILCYEFLYGAPPFEAESQKDTFRRIMKVDLSFPSAPSISAEAKHLISRLLVKDSSKRLSLQKIMEHPWIIKNANPRGTCDI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase Aurora-3 Phosphorylates in vitro histone H3 at 'Ser-10' and 'Ser-28', but not at 'Thr-3' or 'Thr-11'. Colocalizes with phosphorylated histone H3 during mitosis. Associates with cytoskeletal structures that are necessary for cytokinesis and with the microtubule spindle.confidentO64629
Aurora/IPL1-related protein kinase 2 Serine/threonine-protein kinase which mediates both meiotic and mitotic chromosome segregation. Required for histone H3 'Ser-10' phosphorylation. Phosphorylates tlk-1 at 'Ser-634', which enhances its activity. Phosphorylates zen-4 at 'Ser-680'.probableO01427
Spindle assembly checkpoint kinase Required for high-fidelity chromosome segregation during the later part of each cell cycle. Acts in opposition to the phosphatase PP1. Has a role in attaching the kinetochores to the microtubules and ensuring that sister kinetochores connect to opposite poles. The promotion of bi-orientation is achieved by selectively detaching kinetochore-microtubule attachments that are not under tension. Phosphorylates histone H3 to form H3S10ph during mitosis and meiosis.probableQ6BVA0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FDN, chain A
Confidence level:very confident
Coverage over the Query: 14-283
View the alignment between query and template
View the model in PyMOL