BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023326
         (284 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2SQC|A Chain A, Squalene-Hopene Cyclase From Alicyclobacillus
           Acidocaldarius
 pdb|2SQC|B Chain B, Squalene-Hopene Cyclase From Alicyclobacillus
           Acidocaldarius
          Length = 631

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 209 DMPNKIIEVFADMEELGVRPDEDTVRRIASAFQRVGQDDKQKLVLK--KYLSK 259
           D+PN I   F+D  E+   P ED    +   F   G DD  K++ +  +YL +
Sbjct: 427 DLPNHI--PFSDFGEVTDPPSEDVTAHVLECFGSFGYDDAWKVIRRAVEYLKR 477


>pdb|3SQC|A Chain A, Squalene-Hopene Cyclase
 pdb|3SQC|B Chain B, Squalene-Hopene Cyclase
 pdb|3SQC|C Chain C, Squalene-Hopene Cyclase
          Length = 631

 Score = 29.6 bits (65), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 4/53 (7%)

Query: 209 DMPNKIIEVFADMEELGVRPDEDTVRRIASAFQRVGQDDKQKLVLK--KYLSK 259
           D+PN I   F D  E+   P ED    +   F   G DD  K++ +  +YL +
Sbjct: 427 DLPNHI--PFCDFGEVTDPPSEDVTAHVLECFGSFGYDDAWKVIRRAVEYLKR 477


>pdb|1GSZ|A Chain A, Crystal Structure Of A Squalene Cyclase In Complex With
           The Potential Anticholesteremic Drug Ro48-8071
 pdb|1GSZ|B Chain B, Crystal Structure Of A Squalene Cyclase In Complex With
           The Potential Anticholesteremic Drug Ro48-8071
 pdb|1GSZ|C Chain C, Crystal Structure Of A Squalene Cyclase In Complex With
           The Potential Anticholesteremic Drug Ro48-8071
 pdb|1H35|A Chain A, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H35|B Chain B, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H35|C Chain C, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H36|A Chain A, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H36|B Chain B, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H36|C Chain C, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H37|A Chain A, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H37|B Chain B, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H37|C Chain C, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H39|A Chain A, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H39|B Chain B, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H39|C Chain C, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H3A|A Chain A, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H3A|B Chain B, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H3A|C Chain C, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H3B|A Chain A, Squalene-Hopene Cyclase
 pdb|1H3B|B Chain B, Squalene-Hopene Cyclase
 pdb|1H3B|C Chain C, Squalene-Hopene Cyclase
 pdb|1H3C|A Chain A, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H3C|B Chain B, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1H3C|C Chain C, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1O6H|A Chain A, Squalene-Hopene Cyclase
 pdb|1O6H|B Chain B, Squalene-Hopene Cyclase
 pdb|1O6H|C Chain C, Squalene-Hopene Cyclase
 pdb|1O6Q|A Chain A, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1O6Q|B Chain B, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1O6Q|C Chain C, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1O6R|A Chain A, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1O6R|B Chain B, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1O6R|C Chain C, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1O79|A Chain A, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1O79|B Chain B, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1O79|C Chain C, Structures Of Human Oxidosqualene Cyclase Inhibitors Bound
           To A Homolgous Enzyme
 pdb|1UMP|A Chain A, Geometry Of Triterpene Conversion To Pentacarbocyclic
           Hopene
 pdb|1UMP|B Chain B, Geometry Of Triterpene Conversion To Pentacarbocyclic
           Hopene
 pdb|1UMP|C Chain C, Geometry Of Triterpene Conversion To Pentacarbocyclic
           Hopene
 pdb|1SQC|A Chain A, Squalene-Hopene-Cyclase From Alicyclobacillus
           Acidocaldarius
          Length = 631

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 4/53 (7%)

Query: 209 DMPNKIIEVFADMEELGVRPDEDTVRRIASAFQRVGQDDKQKLVLK--KYLSK 259
           D+PN I   F D  E+   P ED    +   F   G DD  K++ +  +YL +
Sbjct: 427 DLPNHI--PFCDFGEVTDPPSEDVTAHVLECFGSFGYDDAWKVIRRAVEYLKR 477


>pdb|3IPC|A Chain A, Structure Of Atu2422-Gaba F77a Mutant Receptor In Complex
           With Leucine
          Length = 356

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 216 EVFADMEELGVRPDED----TVRRIASAFQRVGQDDKQKLVLKKYLSKWKYIHFKGERVR 271
           EV+A+   L + P       T R + + F+  G+DD+Q  +  KYL+     HFK  +V 
Sbjct: 87  EVYAENGILEITPAATNPVFTERGLWNTFRTCGRDDQQGGIAGKYLAD----HFKDAKVA 142

Query: 272 VRRD 275
           +  D
Sbjct: 143 IIHD 146


>pdb|3IP5|A Chain A, Structure Of Atu2422-Gaba Receptor In Complex With Alanine
 pdb|3IP6|A Chain A, Structure Of Atu2422-Gaba Receptor In Complex With Proline
 pdb|3IP7|A Chain A, Structure Of Atu2422-Gaba Receptor In Complex With Valine
 pdb|3IP9|A Chain A, Structure Of Atu2422-Gaba Receptor In Complex With Gaba
 pdb|3IPA|A Chain A, Structure Of Atu2422-Gaba Receptor In Complex With Alanine
          Length = 356

 Score = 28.9 bits (63), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 216 EVFADMEELGVRPDED----TVRRIASAFQRVGQDDKQKLVLKKYLSKWKYIHFKGERVR 271
           EV+A+   L + P       T R + + F+  G+DD+Q  +  KYL+     HFK  +V 
Sbjct: 87  EVYAENGILEITPAATNPVFTERGLWNTFRTCGRDDQQGGIAGKYLAD----HFKDAKVA 142

Query: 272 VRRD 275
           +  D
Sbjct: 143 IIHD 146


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.133    0.415 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,760,216
Number of Sequences: 62578
Number of extensions: 256131
Number of successful extensions: 630
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 629
Number of HSP's gapped (non-prelim): 7
length of query: 284
length of database: 14,973,337
effective HSP length: 98
effective length of query: 186
effective length of database: 8,840,693
effective search space: 1644368898
effective search space used: 1644368898
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)