Citrus Sinensis ID: 023347
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 283 | ||||||
| 255537067 | 375 | nucleic acid binding protein, putative [ | 0.996 | 0.752 | 0.745 | 1e-122 | |
| 224074705 | 300 | predicted protein [Populus trichocarpa] | 0.978 | 0.923 | 0.725 | 1e-120 | |
| 449494370 | 368 | PREDICTED: uncharacterized LOC101211196 | 0.989 | 0.760 | 0.703 | 1e-111 | |
| 356538069 | 393 | PREDICTED: uncharacterized protein LOC10 | 0.982 | 0.707 | 0.683 | 1e-109 | |
| 449460491 | 367 | PREDICTED: uncharacterized protein LOC10 | 0.985 | 0.760 | 0.699 | 1e-109 | |
| 357462889 | 411 | hypothetical protein MTR_3g084750 [Medic | 0.964 | 0.664 | 0.691 | 1e-106 | |
| 356569166 | 356 | PREDICTED: uncharacterized protein LOC10 | 0.893 | 0.710 | 0.707 | 1e-102 | |
| 15234485 | 364 | C2H2 type zinc finger protein [Arabidops | 0.982 | 0.763 | 0.641 | 1e-101 | |
| 297809527 | 365 | zinc finger family protein [Arabidopsis | 0.982 | 0.761 | 0.628 | 1e-101 | |
| 255537065 | 294 | nucleic acid binding protein, putative [ | 0.837 | 0.806 | 0.747 | 1e-99 |
| >gi|255537067|ref|XP_002509600.1| nucleic acid binding protein, putative [Ricinus communis] gi|223549499|gb|EEF50987.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 443 bits (1139), Expect = e-122, Method: Compositional matrix adjust.
Identities = 217/291 (74%), Positives = 247/291 (84%), Gaps = 9/291 (3%)
Query: 1 MVAYANSHAFSYVPQVVREQREERKLFNQLENRGVIKPAEPYVCGVCGRRFYSNEKLVNH 60
MVAYAN HAFSYVP VV+EQR+ERKL N LE +GVIKP EPY+C VCGRRFY+NEKL+NH
Sbjct: 86 MVAYANRHAFSYVPHVVKEQRKERKLLNHLEKKGVIKPVEPYLCRVCGRRFYNNEKLINH 145
Query: 61 FKQIHEREQKKRLNQIESARGKRRVHLVGKYSMKMEKYKRAARAILTPKIGYGLADELKR 120
FKQIHEREQ+KRLNQIESARGKRRV+LV KY+MKM+KYK AAR +LTPK+GYGLADELKR
Sbjct: 146 FKQIHEREQQKRLNQIESARGKRRVNLVAKYAMKMQKYKNAARDVLTPKVGYGLADELKR 205
Query: 121 AGFWVRTVSDKPQAADVALRNHMVDMMDKRHVECLVIVSDDSDFVDVLQEAKYRCLKTVV 180
AGFWV TVSDKPQAADVALR H+VDMMDKR ECLV+VSDDSDFV VL+EAK RC+KTVV
Sbjct: 206 AGFWVTTVSDKPQAADVALREHIVDMMDKRRAECLVLVSDDSDFVGVLKEAKLRCVKTVV 265
Query: 181 VGDINDGALKRIADASFSWRDILMGKAKKEAVSVVGKWEDRDILKRLEWTYSPEVEKK-- 238
VGDINDGALKR+ADA FSW++ILMGKAKKEAVSVVGKW+DRDILK+LEWTY+PE +KK
Sbjct: 266 VGDINDGALKRVADAEFSWQEILMGKAKKEAVSVVGKWKDRDILKKLEWTYNPEEQKKFV 325
Query: 239 AHGWADGNKDA------DIDDATGANNADCIPKEDNGAWWELESSDAEAIS 283
+ + D N D D D + N A+C+ KE GAWWEL +S+ E IS
Sbjct: 326 VNAFNDYNGDTDEIDNGDFDGFSDENGANCMQKEAVGAWWEL-NSETELIS 375
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224074705|ref|XP_002304433.1| predicted protein [Populus trichocarpa] gi|222841865|gb|EEE79412.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449494370|ref|XP_004159528.1| PREDICTED: uncharacterized LOC101211196 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356538069|ref|XP_003537527.1| PREDICTED: uncharacterized protein LOC100785257 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449460491|ref|XP_004147979.1| PREDICTED: uncharacterized protein LOC101211196 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357462889|ref|XP_003601726.1| hypothetical protein MTR_3g084750 [Medicago truncatula] gi|355490774|gb|AES71977.1| hypothetical protein MTR_3g084750 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356569166|ref|XP_003552776.1| PREDICTED: uncharacterized protein LOC100789840 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15234485|ref|NP_192961.1| C2H2 type zinc finger protein [Arabidopsis thaliana] gi|5281035|emb|CAB45971.1| hypothetical proteins [Arabidopsis thaliana] gi|7267925|emb|CAB78267.1| hypothetical proteins [Arabidopsis thaliana] gi|26452877|dbj|BAC43517.1| unknown protein [Arabidopsis thaliana] gi|28973009|gb|AAO63829.1| unknown protein [Arabidopsis thaliana] gi|332657707|gb|AEE83107.1| C2H2 type zinc finger protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297809527|ref|XP_002872647.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297318484|gb|EFH48906.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255537065|ref|XP_002509599.1| nucleic acid binding protein, putative [Ricinus communis] gi|223549498|gb|EEF50986.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 283 | ||||||
| TAIR|locus:2139119 | 364 | AT4G12240 "AT4G12240" [Arabido | 0.978 | 0.760 | 0.615 | 7e-93 | |
| TAIR|locus:2173038 | 396 | AT5G52010 "AT5G52010" [Arabido | 0.734 | 0.525 | 0.426 | 7.5e-41 |
| TAIR|locus:2139119 AT4G12240 "AT4G12240" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 925 (330.7 bits), Expect = 7.0e-93, P = 7.0e-93
Identities = 173/281 (61%), Positives = 215/281 (76%)
Query: 1 MVAYANSHAFSYVPQVVREQREERKLFNQLENRGVIKPAEPYVCGVCGRRFYSNEKLVNH 60
M+AYAN HAFSYVP VREQR++RKL N+LEN+G++KP EPY CGVC RRFY+NEKL+NH
Sbjct: 76 MMAYANRHAFSYVPLEVREQRKDRKLLNKLENKGLVKPPEPYFCGVCDRRFYTNEKLINH 135
Query: 61 FKQIHEREQKKRLNQIESARGKRRVHLVGKYSMKMEKYKRAARAILTPKIGYGLADELKR 120
FKQIHE E +KR+ QIES++G RRV LV KYSMK+EKYKRAAR +LTPK GYGLADELKR
Sbjct: 136 FKQIHETENQKRMRQIESSKGHRRVRLVAKYSMKIEKYKRAARNVLTPKEGYGLADELKR 195
Query: 121 AGFWVRTVSDKPQAADVALRNHMVDMMDKRHVECLXXXXXXXXXXXXLQEAKYRCLKTVV 180
AGFWV+ VSDKP AAD AL+ H+V++MDKR VEC+ L EAK RCL+TVV
Sbjct: 196 AGFWVKMVSDKPDAADKALKEHLVEVMDKREVECVVLVSDDSDFAGILWEAKERCLRTVV 255
Query: 181 VGDINDGALKRIADASFSWRDILMGKAKKEAVSVVGKWEDRDILKRLEWTYSPEVEKKAH 240
+GD N+GALKR+AD ++SW+++ MGKAKKE VVGKW+DRD+LK+LEWTY P +EK+
Sbjct: 256 IGDSNEGALKRVADVAYSWKEVTMGKAKKEVEKVVGKWKDRDVLKKLEWTYDPALEKE-R 314
Query: 241 GWADGNKDADID-DATGANNADCIPKE--DNGAWWELESSD 278
G + G D + D D N + P E D WW++++ D
Sbjct: 315 GGSCGVWDYEFDYDDEIENGTEVEPVEIGDGVDWWKIDTED 355
|
|
| TAIR|locus:2173038 AT5G52010 "AT5G52010" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 283 | |||
| cd06167 | 151 | cd06167, LabA_like, LabA_like proteins | 1e-14 | |
| pfam01936 | 141 | pfam01936, NYN, NYN domain | 6e-08 | |
| COG1432 | 181 | COG1432, COG1432, Uncharacterized conserved protei | 0.002 |
| >gnl|CDD|199895 cd06167, LabA_like, LabA_like proteins | Back alignment and domain information |
|---|
Score = 69.4 bits (170), Expect = 1e-14
Identities = 36/151 (23%), Positives = 61/151 (40%), Gaps = 16/151 (10%)
Query: 59 NHFKQIHEREQKKRLNQ---IESARGKRRVHLVGKYSMKMEKYKRAARAILTPKIGYGLA 115
N + + KRL+ +E LV A P
Sbjct: 9 NLYIGLKRLLGLKRLDLEALLERLLSYADGRLV-------LARAYYNTARPDPSSPDRFQ 61
Query: 116 DELKRAGFWVRTVSD-----KPQAADVALRNHMVDMMDKRHVECLVIVSDDSDFVDVLQE 170
+ L+R GF V V + + DVAL +++ +R ++ +V+VS DSDFV +L+
Sbjct: 62 EALRRLGFEVIRVPRLRGKGEEKGVDVALALDALELAYERRIDTIVLVSGDSDFVPLLER 121
Query: 171 AKYRCLKTVVVGDINDGALKRIADASFSWRD 201
+ R + +VVG A + +A+ + D
Sbjct: 122 LRERGKRVIVVGF-RRSASSALKNAADEFID 151
|
A well conserved group of domains found in all three kingdoms of life, with no defined function. LabA, a member from Synechococcus elongatus PCC 7942, has been shown to play a role in cyanobacterial circadian timing. It is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system. In particular, LabA seems necessary for KaiC-dependent repression of gene expression. Another member is the N-terminal domain of limkain b1, a human autoantigen associated with cytoplasmic vesicles. Curiously, a gene labeled NicB from Pseudomonas putida S16, which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls in the LabA_like family. LabA_like domains exhibit some similarity to the NYN domain, a distant relative of the PIN-domain nucleases. Length = 151 |
| >gnl|CDD|216797 pfam01936, NYN, NYN domain | Back alignment and domain information |
|---|
| >gnl|CDD|224349 COG1432, COG1432, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| cd06167 | 149 | LabA_like LabA_like proteins. A well conserved gro | 98.79 | |
| PF01936 | 146 | NYN: NYN domain; InterPro: IPR021139 This highly c | 98.72 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 98.48 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 98.43 | |
| TIGR00288 | 160 | conserved hypothetical protein TIGR00288. This fam | 98.25 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 97.97 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 97.82 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 97.56 | |
| COG1432 | 181 | Uncharacterized conserved protein [Function unknow | 97.26 | |
| PHA00616 | 44 | hypothetical protein | 97.08 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 97.04 | |
| PHA00733 | 128 | hypothetical protein | 96.94 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 96.93 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 96.89 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 96.69 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 96.54 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 96.12 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 95.5 | |
| PHA00732 | 79 | hypothetical protein | 95.34 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 94.99 | |
| cd05013 | 139 | SIS_RpiR RpiR-like protein. RpiR contains a SIS (S | 94.74 | |
| cd05014 | 128 | SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5 | 94.69 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 94.12 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 94.09 | |
| PRK15482 | 285 | transcriptional regulator MurR; Provisional | 93.47 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 93.19 | |
| PF01380 | 131 | SIS: SIS domain SIS domain web page.; InterPro: IP | 92.5 | |
| TIGR00441 | 154 | gmhA phosphoheptose isomerase. Involved in lipopol | 92.42 | |
| cd05008 | 126 | SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repea | 91.82 | |
| cd05005 | 179 | SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI | 91.51 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 91.37 | |
| PRK11557 | 278 | putative DNA-binding transcriptional regulator; Pr | 91.36 | |
| cd05710 | 120 | SIS_1 A subgroup of the SIS domain. SIS (Sugar ISo | 91.0 | |
| cd01545 | 270 | PBP1_SalR Ligand-binding domain of DNA transcripti | 90.99 | |
| TIGR03127 | 179 | RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of | 90.83 | |
| PRK00414 | 192 | gmhA phosphoheptose isomerase; Reviewed | 90.61 | |
| PRK11337 | 292 | DNA-binding transcriptional repressor RpiR; Provis | 90.51 | |
| PRK13937 | 188 | phosphoheptose isomerase; Provisional | 90.48 | |
| cd05006 | 177 | SIS_GmhA Phosphoheptose isomerase is a member of t | 90.01 | |
| cd06295 | 275 | PBP1_CelR Ligand binding domain of a transcription | 89.84 | |
| PHA00733 | 128 | hypothetical protein | 89.82 | |
| PF04123 | 344 | DUF373: Domain of unknown function (DUF373); Inter | 88.92 | |
| cd06312 | 271 | PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi | 88.85 | |
| cd06282 | 266 | PBP1_GntR_like_2 Ligand-binding domain of putative | 88.65 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 88.39 | |
| PRK13936 | 197 | phosphoheptose isomerase; Provisional | 88.29 | |
| PF13407 | 257 | Peripla_BP_4: Periplasmic binding protein domain; | 87.92 | |
| COG1737 | 281 | RpiR Transcriptional regulators [Transcription] | 87.78 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 87.37 | |
| cd06305 | 273 | PBP1_methylthioribose_binding_like Methylthioribos | 87.25 | |
| cd06281 | 269 | PBP1_LacI_like_5 Ligand-binding domain of uncharac | 86.91 | |
| cd01542 | 259 | PBP1_TreR_like Ligand-binding domain of DNA transc | 86.45 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 86.16 | |
| PRK11302 | 284 | DNA-binding transcriptional regulator HexR; Provis | 85.62 | |
| cd06324 | 305 | PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b | 85.47 | |
| cd06294 | 270 | PBP1_ycjW_transcription_regulator_like Ligand-bind | 85.21 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 85.09 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 85.06 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 84.99 | |
| PRK13938 | 196 | phosphoheptose isomerase; Provisional | 84.91 | |
| cd06318 | 282 | PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi | 84.86 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 84.61 | |
| TIGR02634 | 302 | xylF D-xylose ABC transporter, substrate-binding p | 84.46 | |
| cd06306 | 268 | PBP1_TorT-like TorT-like proteins, a periplasmic b | 84.1 | |
| cd01540 | 289 | PBP1_arabinose_binding Periplasmic L-arabinose-bin | 83.69 | |
| PRK15408 | 336 | autoinducer 2-binding protein lsrB; Provisional | 83.67 | |
| cd06303 | 280 | PBP1_LuxPQ_Quorum_Sensing Periplasmic binding prot | 82.38 | |
| PRK02947 | 246 | hypothetical protein; Provisional | 81.97 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 81.73 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 81.63 | |
| cd06271 | 268 | PBP1_AglR_RafR_like Ligand-binding domain of DNA t | 81.31 | |
| cd06289 | 268 | PBP1_MalI_like Ligand-binding domain of MalI, a tr | 81.28 | |
| cd06313 | 272 | PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi | 81.17 | |
| cd06302 | 298 | PBP1_LsrB_Quorum_Sensing Periplasmic binding domai | 80.98 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 80.89 | |
| TIGR00274 | 291 | N-acetylmuramic acid 6-phosphate etherase. This pr | 80.65 | |
| PRK14101 | 638 | bifunctional glucokinase/RpiR family transcription | 80.61 | |
| cd01541 | 273 | PBP1_AraR Ligand-binding domain of DNA transcripti | 80.49 | |
| cd06322 | 267 | PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b | 80.45 | |
| PRK12342 | 254 | hypothetical protein; Provisional | 80.37 | |
| cd06270 | 268 | PBP1_GalS_like Ligand binding domain of DNA transc | 80.28 |
| >cd06167 LabA_like LabA_like proteins | Back alignment and domain information |
|---|
Probab=98.79 E-value=1.6e-08 Score=83.78 Aligned_cols=83 Identities=31% Similarity=0.447 Sum_probs=70.7
Q ss_pred CchhhhhhhcCeeeeecCC-----CchhHHHHHHHHHHHHHhhcCccEEEEEeCCcchHHHHHHHHHcCCcEEEEccC--
Q 023347 112 YGLADELKRAGFWVRTVSD-----KPQAADVALRNHMVDMMDKRHVECLVIVSDDSDFVDVLQEAKYRCLKTVVVGDI-- 184 (283)
Q Consensus 112 ygla~~L~RaG~~V~~v~d-----kp~aaD~al~~~~~~~~~~~~v~~lvlvsdd~~f~~~l~~ar~~~~~tvvvg~~-- 184 (283)
-.+...|++.||.|..+.. .+.++|.+|.-.|.+.+...+++++||||.|+||+++++.+|++|.+.+|+|-.
T Consensus 55 ~~~~~~L~~~g~~~~~~~~~~~~~~~~~~D~~l~~d~~~~~~~~~~d~ivLvSgD~Df~~~i~~lr~~G~~V~v~~~~~~ 134 (149)
T cd06167 55 RGFLDALRRLGFEPIQKPLRTRGSGKKGVDVALAIDALELAYKRRIDTIVLVSGDSDFVPLVERLRELGKRVIVVGFEAK 134 (149)
T ss_pred HHHHHHHHHCCcEEEEEcceecCCcccCccHHHHHHHHHHhhhcCCCEEEEEECCccHHHHHHHHHHcCCEEEEEccCcc
Confidence 4566788899999998884 567999999999998887889999999999999999999999999999999874
Q ss_pred CCcccccccc
Q 023347 185 NDGALKRIAD 194 (283)
Q Consensus 185 ~~~~l~r~ad 194 (283)
....|.+.||
T Consensus 135 ~s~~L~~~~d 144 (149)
T cd06167 135 TSRELRKAAD 144 (149)
T ss_pred ChHHHHHhCC
Confidence 2244555566
|
A well conserved group of bacterial proteins with no defined function. LabA, a member from Synechococcus elongatus PCC 7942, has been shown to play a role in cyanobacterial circadian timing. It is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system. In particular, LabA seems necessary for KaiC-dependent repression of gene expression. |
| >PF01936 NYN: NYN domain; InterPro: IPR021139 This highly conserved domain has no known function | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >TIGR00288 conserved hypothetical protein TIGR00288 | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >COG1432 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >cd05013 SIS_RpiR RpiR-like protein | Back alignment and domain information |
|---|
| >cd05014 SIS_Kpsf KpsF-like protein | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15482 transcriptional regulator MurR; Provisional | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF01380 SIS: SIS domain SIS domain web page | Back alignment and domain information |
|---|
| >TIGR00441 gmhA phosphoheptose isomerase | Back alignment and domain information |
|---|
| >cd05008 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) | Back alignment and domain information |
|---|
| >cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI) | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11557 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd05710 SIS_1 A subgroup of the SIS domain | Back alignment and domain information |
|---|
| >cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase | Back alignment and domain information |
|---|
| >PRK00414 gmhA phosphoheptose isomerase; Reviewed | Back alignment and domain information |
|---|
| >PRK11337 DNA-binding transcriptional repressor RpiR; Provisional | Back alignment and domain information |
|---|
| >PRK13937 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >cd05006 SIS_GmhA Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily | Back alignment and domain information |
|---|
| >cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PF04123 DUF373: Domain of unknown function (DUF373); InterPro: IPR007254 This archaeal family of unknown function is predicted to be an integral membrane protein with six transmembrane regions | Back alignment and domain information |
|---|
| >cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PRK13936 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A | Back alignment and domain information |
|---|
| >COG1737 RpiR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PRK11302 DNA-binding transcriptional regulator HexR; Provisional | Back alignment and domain information |
|---|
| >cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13938 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02634 xylF D-xylose ABC transporter, substrate-binding protein | Back alignment and domain information |
|---|
| >cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria | Back alignment and domain information |
|---|
| >cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily | Back alignment and domain information |
|---|
| >PRK15408 autoinducer 2-binding protein lsrB; Provisional | Back alignment and domain information |
|---|
| >cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs | Back alignment and domain information |
|---|
| >PRK02947 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria | Back alignment and domain information |
|---|
| >cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >TIGR00274 N-acetylmuramic acid 6-phosphate etherase | Back alignment and domain information |
|---|
| >PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >PRK12342 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 283 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-06 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-04 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-04 | |
| 2qip_A | 165 | Protein of unknown function VPA0982; APC85975, vib | 5e-04 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 5e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 46.4 bits (109), Expect = 6e-06
Identities = 41/379 (10%), Positives = 99/379 (26%), Gaps = 131/379 (34%)
Query: 13 VPQVVREQREE---RKLFNQLENRGVIKPAEPYVCGVCGRRFYSNEKLVNH---FKQIHE 66
+ ++ + +LF L + K E ++F +N+ I
Sbjct: 51 IDHIIMSKDAVSGTLRLFWTLLS----KQEEMV------QKFVEEVLRINYKFLMSPIKT 100
Query: 67 REQKKRLNQI--ESARGK--RRVHLVGKYSM-KMEKYKRAARAI--LTPKIG---YG--- 113
+++ + R + + KY++ +++ Y + +A+ L P G
Sbjct: 101 EQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLG 160
Query: 114 -----LADELKRAG----------FWVRTVSDKPQAADV----------------ALRNH 142
+A ++ + FW+ + + V + +H
Sbjct: 161 SGKTWVALDVCLSYKVQCKMDFKIFWL-NLKNCNSPETVLEMLQKLLYQIDPNWTSRSDH 219
Query: 143 MVD---------------MMDKRHVECLVIVSD---------------------DSDFVD 166
+ + K + CL+++ + D
Sbjct: 220 SSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTD 279
Query: 167 VLQEAKYRCLKTVVVGDINDGALKRIADASFS-WRDILMGKAKKEA-------VSVVGKW 218
L A + + + + + D +E +S++ +
Sbjct: 280 FLSAATT---THISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAE- 335
Query: 219 EDRDILKRLEWTYSPEVEKKAHGWADGNK--DADIDDATGANNADC------------IP 264
RD L W V ++ ++ A IP
Sbjct: 336 SIRDGLAT--WDNWKHVNCDKL-----TTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIP 388
Query: 265 KEDNGA-WWELESSDAEAI 282
W+++ SD +
Sbjct: 389 TILLSLIWFDVIKSDVMVV 407
|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2qip_A Protein of unknown function VPA0982; APC85975, vibrio parahaemolyticus RIMD 2210633, STR genomics, PSI-2, protein structure initiative; 1.48A {Vibrio parahaemolyticus} Length = 165 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.04 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 98.76 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 98.74 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.74 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 98.73 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.73 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.73 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.73 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.73 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.73 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 98.73 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 98.72 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.72 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.72 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 98.72 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.72 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 98.72 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.72 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 98.72 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.71 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.71 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.71 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.71 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.71 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.71 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.71 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.71 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.71 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.71 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.71 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.7 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.7 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.7 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.7 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.7 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.7 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.7 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.69 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.69 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.69 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.69 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.69 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.69 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.69 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.69 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.69 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.69 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.69 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 98.69 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.69 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.68 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.68 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.68 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.68 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.68 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.68 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 98.68 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.68 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.68 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.68 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.68 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.67 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.67 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.67 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.67 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.67 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.67 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.67 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.67 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.67 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.66 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.66 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.66 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 98.66 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.66 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.66 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.66 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.65 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 98.65 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 98.65 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.65 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.65 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 98.65 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.64 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.64 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.64 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.64 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 98.64 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.64 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.64 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.64 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.63 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.63 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.63 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.61 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.61 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.61 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.6 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 98.59 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.59 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 98.58 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 98.58 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.58 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 98.57 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.56 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.56 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.56 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.55 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 98.55 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 98.54 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 98.53 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.53 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.5 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 98.5 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 98.49 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 98.48 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.48 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 98.46 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 98.46 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 98.45 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 98.44 | |
| 2qip_A | 165 | Protein of unknown function VPA0982; APC85975, vib | 98.43 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 98.42 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 98.4 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 98.4 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.4 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 98.38 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 98.38 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.38 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 98.37 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 98.37 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.37 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 98.36 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 98.35 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.35 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.35 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 98.34 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 98.34 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 98.33 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 98.33 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.33 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 98.32 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 98.32 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 98.31 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 98.3 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 98.29 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 98.28 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 98.27 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 98.25 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.23 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 98.23 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.22 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 98.21 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 98.21 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 98.21 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 98.19 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.18 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 98.17 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 98.17 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 98.16 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 98.16 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 98.15 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 98.13 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 98.13 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 98.12 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 98.12 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.11 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 98.09 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 98.08 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 98.06 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 98.06 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.05 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 98.02 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 98.02 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 98.01 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 98.01 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.0 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 97.99 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 97.99 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 97.98 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 97.98 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 97.98 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 97.97 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 97.96 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 97.96 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 97.96 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 97.94 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 97.93 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.93 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 97.93 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 97.92 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 97.92 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 97.91 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 97.91 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 97.9 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 97.89 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.88 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 97.88 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 97.09 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 97.87 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 97.86 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 97.86 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 97.86 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 97.86 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.06 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 97.84 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 97.83 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 97.82 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 97.8 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 97.8 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 97.78 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 97.75 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 97.73 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 97.73 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.72 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 97.72 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 97.69 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.68 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 97.61 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 97.58 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 97.57 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 97.53 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 96.65 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 97.42 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 97.41 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 97.34 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 97.34 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 97.25 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 97.2 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 96.86 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 96.79 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 96.36 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 96.08 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 95.4 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 95.28 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 95.21 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 94.01 | |
| 2l69_A | 134 | Rossmann 2X3 fold protein; structural genomics, no | 93.87 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.53 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 93.45 | |
| 3sho_A | 187 | Transcriptional regulator, RPIR family; structural | 93.44 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 93.35 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.35 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.22 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 93.19 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.19 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 93.19 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 93.09 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.08 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 93.08 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.08 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.02 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.95 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 92.95 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.93 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.93 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.9 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.83 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 92.82 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 92.81 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.65 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 92.63 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.52 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 92.33 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 92.32 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.27 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.26 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 92.23 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.22 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.21 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.2 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 92.19 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 92.17 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.17 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.17 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.16 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 92.12 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.1 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.09 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 92.01 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.99 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.98 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.98 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 91.97 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 91.96 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.92 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 91.91 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.84 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 91.83 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.8 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.78 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.77 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.72 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.71 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.71 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.7 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.68 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.63 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 91.62 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 91.6 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.59 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.57 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.56 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.53 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.51 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.5 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.48 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.46 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.41 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.4 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 91.35 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.32 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 91.25 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 91.23 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.23 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.22 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.16 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.12 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.06 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.04 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.03 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.97 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.93 | |
| 2xbl_A | 198 | Phosphoheptose isomerase; capsule; HET: M7P PGE PG | 90.82 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 90.81 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.64 | |
| 1tk9_A | 188 | Phosphoheptose isomerase 1; lipopolysaccharide bio | 90.63 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.57 | |
| 1jeo_A | 180 | MJ1247, hypothetical protein MJ1247; RUMP pathway, | 90.53 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.49 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 90.47 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.44 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 90.35 | |
| 1m3s_A | 186 | Hypothetical protein YCKF; structural genomics, PS | 90.33 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 90.24 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.12 | |
| 2yva_A | 196 | DNAA initiator-associating protein DIAA; intermole | 89.97 | |
| 2i2w_A | 212 | Phosphoheptose isomerase; lipopolysaccharide biosy | 89.77 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 89.57 | |
| 3trj_A | 201 | Phosphoheptose isomerase; lipopolysaccharide biosy | 89.34 | |
| 2xhz_A | 183 | KDSD, YRBH, arabinose 5-phosphate isomerase; lipop | 87.98 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 87.41 | |
| 1x92_A | 199 | APC5045, phosphoheptose isomerase; midwest centre | 87.17 | |
| 1vim_A | 200 | Hypothetical protein AF1796; structural genomics, | 87.14 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.96 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 86.9 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 86.79 | |
| 3ksm_A | 276 | ABC-type sugar transport system, periplasmic COMP; | 86.78 | |
| 3jy6_A | 276 | Transcriptional regulator, LACI family; NYSGXRC, P | 86.74 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 86.59 | |
| 3h75_A | 350 | Periplasmic sugar-binding domain protein; protein | 86.51 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.33 | |
| 3fxa_A | 201 | SIS domain protein; structural genomics, joint cen | 86.22 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 85.94 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 85.88 | |
| 3etn_A | 220 | Putative phosphosugar isomerase involved in capsu | 84.57 | |
| 3o74_A | 272 | Fructose transport system repressor FRUR; dual tra | 84.4 | |
| 3cvj_A | 243 | Putative phosphoheptose isomerase; rossman fold, 3 | 84.25 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 84.22 | |
| 3l6u_A | 293 | ABC-type sugar transport system periplasmic compo; | 84.13 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 84.05 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 82.8 | |
| 3gbv_A | 304 | Putative LACI-family transcriptional regulator; NY | 82.42 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 82.13 | |
| 3m9w_A | 313 | D-xylose-binding periplasmic protein; xylose bindi | 82.12 | |
| 3k4h_A | 292 | Putative transcriptional regulator; structural gen | 82.01 | |
| 3tb6_A | 298 | Arabinose metabolism transcriptional repressor; tr | 81.91 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 81.75 | |
| 3l49_A | 291 | ABC sugar (ribose) transporter, periplasmic substr | 81.67 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 81.04 | |
| 3hcw_A | 295 | Maltose operon transcriptional repressor; RNA-bind | 80.83 | |
| 3huu_A | 305 | Transcription regulator like protein; PSI-II, NYSG | 80.77 | |
| 1nri_A | 306 | Hypothetical protein HI0754; structural genomics, | 80.54 | |
| 2zj3_A | 375 | Glucosamine--fructose-6-phosphate aminotransferase | 80.53 | |
| 3g68_A | 352 | Putative phosphosugar isomerase; SIS domain, doubl | 80.52 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 80.48 | |
| 2fn9_A | 290 | Ribose ABC transporter, periplasmic ribose-bindin; | 80.43 | |
| 2ioy_A | 283 | Periplasmic sugar-binding protein; ribose binding | 80.37 | |
| 3knz_A | 366 | Putative sugar binding protein; structural genomic | 80.16 |
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
Probab=99.04 E-value=5.9e-11 Score=85.60 Aligned_cols=52 Identities=19% Similarity=0.406 Sum_probs=47.0
Q ss_pred CCCCccCCCCCCccCCchhHhhhhhcccccccc-------ccccCchhhhhhhhhhhhhh
Q 023347 38 PAEPYVCGVCGRRFYSNEKLVNHFKQIHEREQK-------KRLNQIESARGKRRVHLVGK 90 (283)
Q Consensus 38 GEKPykC~vCGKsFss~ssLkrH~KriHtGEK~-------Krf~~~~sl~~hrR~h~~~k 90 (283)
.|+||.|.+||+.|.....|..|+ ++|++++| +.|.+.+.|+.|+++|++++
T Consensus 1 SEKpy~C~~C~k~F~~~~~L~~H~-~~Ht~ekp~~C~~C~k~F~~~~~L~~H~~~Htgep 59 (60)
T 4gzn_C 1 SERPFFCNFCGKTYRDASGLSRHR-RAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKP 59 (60)
T ss_dssp CCCCEECTTTCCEESSHHHHHHHH-HHHHTCCCEECTTTCCEESSHHHHHHHGGGGSCC-
T ss_pred CCCCccCCCCCCEeCCHHHHHHHH-HHhCCCcCeECCCCCCCcCCHHHHHHHhCccCCCC
Confidence 479999999999999999999999 99999994 88889999999999998763
|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qip_A Protein of unknown function VPA0982; APC85975, vibrio parahaemolyticus RIMD 2210633, STR genomics, PSI-2, protein structure initiative; 1.48A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2l69_A Rossmann 2X3 fold protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >3sho_A Transcriptional regulator, RPIR family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.80A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2xbl_A Phosphoheptose isomerase; capsule; HET: M7P PGE PG4; 1.62A {Burkholderia pseudomallei} PDB: 2x3y_A | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1tk9_A Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1jeo_A MJ1247, hypothetical protein MJ1247; RUMP pathway, phosphosugar, 3-hexulose-6-phosphate isomerase structural genomics; HET: CME CIT; 2.00A {Methanocaldococcus jannaschii} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1m3s_A Hypothetical protein YCKF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} SCOP: c.80.1.3 PDB: 1viv_A | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yva_A DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar BIND protein, DNAA binding protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2i2w_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3trj_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 2.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2xhz_A KDSD, YRBH, arabinose 5-phosphate isomerase; lipopolysaccharide biogenesis; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x92_A APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} SCOP: c.80.1.3 PDB: 3bjz_A | Back alignment and structure |
|---|
| >1vim_A Hypothetical protein AF1796; structural genomics, unknown function; 1.36A {Archaeoglobus fulgidus} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} | Back alignment and structure |
|---|
| >3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fxa_A SIS domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3etn_A Putative phosphosugar isomerase involved in capsu formation; YP_209877.1; HET: MSE CMK; 1.70A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* | Back alignment and structure |
|---|
| >3cvj_A Putative phosphoheptose isomerase; rossman fold, 3-layer (ABA) sandwich, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.00A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* | Back alignment and structure |
|---|
| >3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} | Back alignment and structure |
|---|
| >3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >1nri_A Hypothetical protein HI0754; structural genomics, haemophilus influ PSI, protein structure initiative, midwest center for struc genomics; 1.90A {Haemophilus influenzae} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >2zj3_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1; glucosamine-6-phosphate synthase, aldose/ketose isomerase, rossmann-like fold; HET: G6P; 1.90A {Homo sapiens} PDB: 2zj4_A* 2v4m_A* | Back alignment and structure |
|---|
| >3g68_A Putative phosphosugar isomerase; SIS domain, double-SIS DOMA protein, structural genomics, joint center for structural G JCSG; HET: MSE CIT; 1.80A {Clostridium difficile} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* | Back alignment and structure |
|---|
| >2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >3knz_A Putative sugar binding protein; structural genomics, joint C structural genomics, JCSG, protein structure initiative; 2.50A {Salmonella enterica subsp} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 283 | ||||
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 1e-05 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 3e-04 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 0.001 | |
| d2adra2 | 31 | g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Sac | 0.001 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 0.003 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.003 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 0.003 |
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: PATZ1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 39.2 bits (92), Expect = 1e-05
Identities = 12/28 (42%), Positives = 16/28 (57%)
Query: 41 PYVCGVCGRRFYSNEKLVNHFKQIHERE 68
PY+C CG+ F + L H KQ+H E
Sbjct: 5 PYICQSCGKGFSRPDHLNGHIKQVHTSE 32
|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 31 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 99.08 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.97 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 98.85 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.83 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.77 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.72 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 98.67 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.66 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 98.6 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.57 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.49 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.45 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.43 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.34 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 98.14 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.07 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.05 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.84 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.75 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 97.64 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.58 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.35 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.26 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.23 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.98 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 96.7 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 96.67 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.52 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.49 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 96.3 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 96.16 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 96.09 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 95.87 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 95.68 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 95.54 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 95.53 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 95.42 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 95.41 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 95.31 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 95.16 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 95.13 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 95.12 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 94.81 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 94.2 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 94.18 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 94.12 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 93.32 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 93.11 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 93.05 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 93.04 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 92.64 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 92.38 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 91.86 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 90.93 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 90.3 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 90.08 | |
| d1vima_ | 192 | Hypothetical protein AF1796 {Archaeon Archaeoglobu | 89.04 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 88.64 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 88.56 | |
| d1m3sa_ | 186 | Hypothetical protein YckF {Bacillus subtilis [TaxI | 88.28 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 88.2 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 87.22 | |
| d1x94a_ | 191 | Phosphoheptose isomerase GmhA1 {Vibrio cholerae [T | 87.18 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 86.56 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 86.41 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 84.42 | |
| d1jyea_ | 271 | Lac-repressor (lacR) core (C-terminal domain) {Esc | 84.36 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 83.83 | |
| d2dria_ | 271 | D-ribose-binding protein {Escherichia coli, strain | 83.54 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 82.68 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 81.16 | |
| d1dbqa_ | 282 | Purine repressor (PurR), C-terminal domain {Escher | 80.98 |
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger and SCAN domain-containing protein 16, ZSCAN16 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.08 E-value=1.9e-11 Score=80.28 Aligned_cols=37 Identities=24% Similarity=0.490 Sum_probs=35.7
Q ss_pred hhhcccCCCCCccCCCCCCccCCchhHhhhhhcccccc
Q 023347 31 ENRGVIKPAEPYVCGVCGRRFYSNEKLVNHFKQIHERE 68 (283)
Q Consensus 31 EhqriHTGEKPykC~vCGKsFss~ssLkrH~KriHtGE 68 (283)
.|+++|++++||.|.+||++|...+.|..|+ ++|+||
T Consensus 2 rH~~~Ht~ekpy~C~~CgK~F~~~s~L~~H~-r~HtGE 38 (38)
T d2cota2 2 RSEWQQRERRRYKCDECGKSFSHSSDLSKHR-RTHTGE 38 (38)
T ss_dssp CCCSCCCCSCSSBCSSSCCBCSCHHHHHHHH-TTTCCS
T ss_pred ccCcccCCCCCEecCCCCceeeCHHHHHHhC-ccCCCC
Confidence 5899999999999999999999999999999 999997
|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vima_ c.80.1.3 (A:) Hypothetical protein AF1796 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3sa_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|