BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023355
         (283 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LIZ|H Chain H, Crystal Structure Of Bla G 2 Complexed With Fab 4c3
          Length = 253

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 9/47 (19%)

Query: 29 GLVSDAFHLTFGCGL--LTFSMFAMAASRQKPDFAYTYGYKRLEVLS 73
          GLV     L   C     TFS FAM+  RQ PD       KRLE+++
Sbjct: 10 GLVQPGGSLKLSCAASGFTFSSFAMSWGRQTPD-------KRLELVA 49


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.139    0.419 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,459,237
Number of Sequences: 62578
Number of extensions: 263571
Number of successful extensions: 541
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 541
Number of HSP's gapped (non-prelim): 1
length of query: 283
length of database: 14,973,337
effective HSP length: 98
effective length of query: 185
effective length of database: 8,840,693
effective search space: 1635528205
effective search space used: 1635528205
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)