Citrus Sinensis ID: 023355

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---

MKRLFLLISLNVAYSTAELAIGLFTGRVGLVSDAFHLTFGCGLLTFSMFAMAASRQKPDFAYTYGYKRLEVLSAFTNALFLLFMSFSLAVEALHAFIQDESEHKHYLIVSAVTNLLVNLIGVWFFRNYARINLVYRNPEDMNYHSVCLHVLADSIRSAGLILASWFLSLGVQNAEVLCLGIVSVAVFMLVMPLFKVTGGILLQMAPPSIPSSALSKCWRQIVSREDVTEVSQARFWELVPGHVVGSLSLQVNKGVDDRPILQFVHGLYHDLGVQDLTVQIDYD

cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccEEEEcccccCEEEEEEEEccccccHHHHHHHHHHHHHccccccEEEcccc

MKRLFLLISLNVAYSTAELAIGLFTGRVGLVSDAFHLTFGCGLLTFSMFAMAASRQKPDFAYTYGYKRLEVLSAFTNALFLLFMSFSLAVEALHAFIQDESEHKHYLIVSAVTNLLVNLIGVWFFRNYAR********EDMNYHSVCLHVLADSIRSAGLILASWFLSLGVQNAEVLCLGIVSVAVFMLVMPLFKVTGGILLQMAPPSIPSSALSKCWRQIVSREDVTEVSQARFWELVPGHVVGSLSLQVNKGVDDRPILQFVHGLYHDLGVQDLTVQIDY*

xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Metal tolerance protein C2	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	probable	Q6ICY4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H90, chain A
Confidence level:very confident
Coverage over the Query: 17-283
View the alignment between query and template
View the model in PyMOL