Citrus Sinensis ID: 023356

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---

MASIWIPCPKISWVAPVGSTGGQQPQQQKQMLSFQNSSNSNPSLSFASSAPFSGFQCSIKKQSAVWKVQAKVIAKKPLNSTAAVDTGSEVASSEEKVESAEKKIPDASAISAFMTQVSDLVKLVDSRDIMELQMKQSDCELIVRKKEALQPPECIVNMPPTMPHMMYPTPPPAAPAAAPTPAPAPASPASSVPVPALPPPAKKSSHPPLKCPMAGTFYRCPAPGEPAFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIVP

cccccccccccEEEccccccccccccccccccEEcccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccEEccccEEEEEEEcccccccccccccEEEEEEccccccccccccEEEEcc

***IWIPCPKISWVAPV************************************GFQCSIKKQSAVWKVQAKVIA***********************************ISAFMTQVSDLVKLVDSRDIMELQMKQSDCELIVRKKEAL**********************************************************PLKCPMAGTFYRCPAPGEPAFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIVP

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic	This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.	probable	Q9LLC1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BDO, chain A
Confidence level:very confident
Coverage over the Query: 207-282
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3v1v, chain A		probable	Alignment \| Template Structure