Query         023388
Match_columns 283
No_of_seqs    27 out of 29
Neff          1.9 
Searched_HMMs 46136
Date          Fri Mar 29 03:39:43 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/023388.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/023388hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03423 CBM_25:  Carbohydrate   97.6   8E-05 1.7E-09   56.8   4.1   76  106-186     1-77  (87)
  2 PLN02316 synthase/transferase   96.5  0.0072 1.6E-07   64.1   7.2   93   99-195   321-418 (1036)
  3 PLN02316 synthase/transferase   96.2   0.011 2.3E-07   62.9   6.5  124   99-228   483-632 (1036)
  4 PF14125 DUF4292:  Domain of un  56.0      15 0.00033   31.1   3.6   38  160-198   169-208 (210)
  5 PF06200 tify:  tify domain;  I  51.8      12 0.00025   25.9   1.8   14  102-115     1-14  (36)
  6 PF06830 Root_cap:  Root cap;    45.3      10 0.00022   28.8   0.9   22  126-148    23-44  (57)
  7 PF14524 Wzt_C:  Wzt C-terminal  43.8      32  0.0007   25.7   3.4   78   92-172    17-97  (142)
  8 smart00809 Alpha_adaptinC2 Ada  38.8      77  0.0017   23.4   4.7   37  163-199    12-49  (104)
  9 cd00418 GlxRS_core catalytic c  37.9      32  0.0007   31.1   3.0   28  180-217    64-92  (230)
 10 cd01514 Elongation_Factor_C El  36.0      11 0.00024   27.1  -0.2   39  157-195     1-48  (79)
 11 PF02883 Alpha_adaptinC2:  Adap  36.0      94   0.002   23.6   4.9   32  167-198    22-54  (115)
 12 PRK11385 putativi pili assembl  35.8      35 0.00075   30.8   2.8   37   89-125   110-156 (236)
 13 PF05773 RWD:  RWD domain;  Int  33.9      96  0.0021   22.6   4.5   63  151-214    23-93  (113)
 14 PF10102 DUF2341:  Domain of un  31.5      56  0.0012   25.6   3.0   41   80-121    16-59  (89)
 15 PRK10150 beta-D-glucuronidase;  29.1      41  0.0009   33.0   2.4   47  162-209    43-91  (604)
 16 PRK15195 fimbrial chaperone pr  25.8      64  0.0014   28.8   2.8   35   90-124   103-151 (229)
 17 PRK15188 fimbrial chaperone pr  24.8      72  0.0016   28.8   2.9   37   89-125   104-153 (228)
 18 PF01630 Glyco_hydro_56:  Hyalu  24.7      48   0.001   32.0   1.9   33  104-136    44-76  (337)
 19 PF05393 Hum_adeno_E3A:  Human   24.6      44 0.00095   27.7   1.4   30  149-178    55-93  (94)
 20 PF11619 P53_C:  Transcription   23.8      52  0.0011   26.1   1.6   13  184-196    14-26  (71)
 21 smart00216 VWD von Willebrand   23.5      92   0.002   24.6   3.0   20  181-200   122-141 (162)
 22 PF00094 VWD:  von Willebrand f  21.6 1.5E+02  0.0033   22.6   3.8   32  169-200   104-137 (159)
 23 cd03713 EFG_mtEFG_C EFG_mtEFG_  21.5      32 0.00069   24.7   0.0   36  157-195     1-47  (78)
 24 PHA02739 hypothetical protein;  21.1      76  0.0017   26.9   2.2   26  188-213     2-27  (116)
 25 TIGR01943 rnfA electron transp  21.0      50  0.0011   29.5   1.2   19  192-210   161-179 (190)
 26 PF05725 FNIP:  FNIP Repeat;  I  20.7      77  0.0017   21.2   1.8   22  121-142    10-31  (44)
 27 PRK15285 putative fimbrial cha  20.2      94   0.002   28.4   2.8   36   89-124   105-150 (250)
 28 PF11763 DIPSY:  Cell-wall adhe  20.1 1.3E+02  0.0029   26.0   3.5   39  157-203    47-86  (123)

No 1  
>PF03423 CBM_25:  Carbohydrate binding domain (family 25);  InterPro: IPR005085 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM25 from CAZY which has a starch-binding function as has been demonstrated in one case.; PDB: 2LAB_A 2C3X_B 2C3V_A 2C3W_C 2LAA_A.
Probab=97.60  E-value=8e-05  Score=56.83  Aligned_cols=76  Identities=24%  Similarity=0.501  Sum_probs=39.4

Q ss_pred             CCceEEEEccccCCCCCCCcceeeecCCCCCccccCCchhhhhhhhhCCCCCCceEEEeeeccceeeEEEEeecC-CCCC
Q 023388          106 GEKLKIFYNPYAKKLLPNEDFGIGFNGSFNQPFMCGGEPRAMLRKNRGQNDSPFYTIQICVPKHAINLIFSFTNG-VEWD  184 (283)
Q Consensus       106 Ge~L~lfyNp~as~l~PNe~fGiaFNGgFNQPIMCGGEPR~M~~k~RGkad~PiYtI~I~vPkHa~~LiFSFTnG-~~WD  184 (283)
                      |+.++|||||..+.|.-..  -|=..+|||. -. ....-.|.+... .....-++..|.||+.|..|.|-|+|| -.||
T Consensus         1 G~~vtVyYn~~~~~l~g~~--~v~~~~G~n~-W~-~~~~~~m~~~~~-~~~~~~~~~tv~vP~~a~~~dfvF~dg~~~wD   75 (87)
T PF03423_consen    1 GETVTVYYNPSLTALSGAP--NVHLHGGFNR-WT-HVPGFGMTKMCV-PDEGGWWKATVDVPEDAYVMDFVFNDGAGNWD   75 (87)
T ss_dssp             -SEEEEEE---E-SSS-S---EEEEEETTS--B--SSS-EE-EEESS----TTEEEEEEE--TTTSEEEEEEE-SSS-EE
T ss_pred             CCEEEEEEEeCCCCCCCCC--cEEEEecCCC-CC-cCCCCCcceeee-eecCCEEEEEEEEcCCceEEEEEEcCCCCcEe
Confidence            7899999999877775222  2444445542 11 111223433221 111678999999999999999999998 4788


Q ss_pred             Cc
Q 023388          185 GP  186 (283)
Q Consensus       185 Gp  186 (283)
                      --
T Consensus        76 NN   77 (87)
T PF03423_consen   76 NN   77 (87)
T ss_dssp             ST
T ss_pred             CC
Confidence            53


No 2  
>PLN02316 synthase/transferase
Probab=96.45  E-value=0.0072  Score=64.09  Aligned_cols=93  Identities=19%  Similarity=0.330  Sum_probs=69.1

Q ss_pred             CCCCCCCCCceEEEEccccCCCCCCCcceeeecCCCCCccccCCchhhhhhhhhCCCCCCceEEEeeeccceeeEEEEee
Q 023388           99 NGLPPMSGEKLKIFYNPYAKKLLPNEDFGIGFNGSFNQPFMCGGEPRAMLRKNRGQNDSPFYTIQICVPKHAINLIFSFT  178 (283)
Q Consensus        99 nGlpP~sGe~L~lfyNp~as~l~PNe~fGiaFNGgFNQPIMCGGEPR~M~~k~RGkad~PiYtI~I~vPkHa~~LiFSFT  178 (283)
                      ....|-+|+.++|||||+-+.|.-.+  -|=+.||||.=..-.+.+-.|.+-+.+.-+  .+.-.|.||+-|..|-|-|+
T Consensus       321 ~P~~~~aG~~v~lyYN~~~~~L~~~~--~v~i~gg~N~W~~~~~~~~~~~~~~~~~g~--ww~a~v~vP~~A~~mDfVFs  396 (1036)
T PLN02316        321 EPSEFKAGDTVKLYYNRSSGPLAHST--EIWIHGGYNNWIDGLSIVEKLVKSEEKDGD--WWYAEVVVPERALVLDWVFA  396 (1036)
T ss_pred             cCCCcCCCCEEEEEECCCCCCCCCCC--cEEEEEeEcCCCCCCcccceeecccCCCCC--EEEEEEecCCCceEEEEEEe
Confidence            35678999999999999999986433  467788888644333322234443433333  88999999999999999999


Q ss_pred             cC-----CCCCCceeEEEecCc
Q 023388          179 NG-----VEWDGPYRIKFLVPR  195 (283)
Q Consensus       179 nG-----~~WDGpY~L~f~VP~  195 (283)
                      ||     ..||--....|.+|=
T Consensus       397 dg~~~~~~~yDNn~~~Dyh~~v  418 (1036)
T PLN02316        397 DGPPGNARNYDNNGRQDFHAIV  418 (1036)
T ss_pred             cCCcccccccccCCCcceeeec
Confidence            99     699988777776654


No 3  
>PLN02316 synthase/transferase
Probab=96.15  E-value=0.011  Score=62.86  Aligned_cols=124  Identities=22%  Similarity=0.334  Sum_probs=87.6

Q ss_pred             CCCCCCCCCceEEEEccccCCCCCCCcceeeecCCCCCccccCC--chhhhhhhhhCCCCCCceEEEeeeccceeeEEEE
Q 023388           99 NGLPPMSGEKLKIFYNPYAKKLLPNEDFGIGFNGSFNQPFMCGG--EPRAMLRKNRGQNDSPFYTIQICVPKHAINLIFS  176 (283)
Q Consensus        99 nGlpP~sGe~L~lfyNp~as~l~PNe~fGiaFNGgFNQPIMCGG--EPR~M~~k~RGkad~PiYtI~I~vPkHa~~LiFS  176 (283)
                      .=+-|.+|+.++|||||.-+-|.-..+  |=|-||||.=.---|  .|-.|.+.+-|    .-+.-.|.||.-|..+-|-
T Consensus       483 eP~~~~aG~~v~v~Yn~~~t~l~~~~e--v~~~g~~NrWth~~~~~~~~~m~~~~~g----~~~~a~v~vP~da~~mdfv  556 (1036)
T PLN02316        483 EPLEVQAGTTVTVLYNPANTVLNGKPE--VWFRGSFNRWTHRLGPLPPQKMVPADNG----SHLKATVKVPLDAYMMDFV  556 (1036)
T ss_pred             cCCCCCCCCEEEEEECCCCCcCCCCce--EEEEccccCcCCCCCCCCceeeeecCCC----ceEEEEEEccccceEEEEE
Confidence            345689999999999999888875444  779999997555555  58888888766    5778999999999999999


Q ss_pred             eecCC---CCCCceeEEEecCcc---------------cccCCh------hhhhhhHHHhhhccCcccccccCCCc
Q 023388          177 FTNGV---EWDGPYRIKFLVPRA---------------WRNKPM------DFFNKGLADQLSKDGACEKAIFPDTD  228 (283)
Q Consensus       177 FTnG~---~WDGpY~L~f~VP~~---------------~~nkP~------~fFneGLa~eLs~eGACd~AIfPd~~  228 (283)
                      |.+|-   .||--....+.+|-.               +---|.      .=.=-+|+++|.+.|.--.-|-|.-.
T Consensus       557 Fs~~~~g~~yDn~~~~dyh~~v~g~~~~~~pM~Il~VSsE~~P~aKvGGLgDVV~sLp~ALa~~Gh~V~VitP~Y~  632 (1036)
T PLN02316        557 FSEKEEGGIFDNRNGLDYHIPVFGGIAKEPPMHIVHIAVEMAPIAKVGGLGDVVTSLSRAVQDLNHNVDIILPKYD  632 (1036)
T ss_pred             EecCCCCCCcCCCCCcCCcccccCCCCCCCCcEEEEEEcccCCCCCcCcHHHHHHHHHHHHHHcCCEEEEEecCCc
Confidence            96653   466655554444321               111121      12336788999999976566666543


No 4  
>PF14125 DUF4292:  Domain of unknown function (DUF4292)
Probab=55.96  E-value=15  Score=31.09  Aligned_cols=38  Identities=24%  Similarity=0.610  Sum_probs=30.2

Q ss_pred             eEEEeeecc--ceeeEEEEeecCCCCCCceeEEEecCcccc
Q 023388          160 YTIQICVPK--HAINLIFSFTNGVEWDGPYRIKFLVPRAWR  198 (283)
Q Consensus       160 YtI~I~vPk--Ha~~LiFSFTnG~~WDGpY~L~f~VP~~~~  198 (283)
                      ..|+|.++.  .-+.|.+.|.+ ++++.|..+.|.||++++
T Consensus       169 ~~i~i~~~~~~~~~~l~l~y~~-v~~n~~~~f~f~iP~~yk  208 (210)
T PF14125_consen  169 KEIEISAPDGKKKTKLNLEYSK-VEFNEPLSFPFSIPSGYK  208 (210)
T ss_pred             cEEEEEEecCCceEEEEEEEee-eEcCCCcceeccCCCCcE
Confidence            467777777  66666666666 888999999999999876


No 5  
>PF06200 tify:  tify domain;  InterPro: IPR010399 The tify domain is a 36-amino acid domain only found among Embryophyta (land plants). It has been named after the most conserved amino acid pattern (TIF[F/Y]XG) it contains, but was previously known as the Zim domain. As the use of uppercase characters (TIFY) might imply that the domain is fully conserved across proteins, a lowercase lettering has been chosen in an attempt to highlight the reality of its natural variability.  Based on the domain architecture, tify domain containing proteins can be classified into two groups. Group I is formed by proteins possessing a CCT (CONSTANS, CO-like, and TOC1) domain and a GATA-type zinc finger in addition to the tify domain. Group II contains proteins characterised by the tify domain but lacking a GATA-type zinc finger. Tify domain containing proteins might be involved in developmental processes and some of them have features that are characteristic for transcription factors: a nuclear localisation and the presence of a putative DNA-binding domain []. Some proteins known to contain a tify domain include:   Arabidopsis thaliana Zinc-finger protein expressed in Inflorescence Meristem (ZIM), a putative transcription factor involved in inflorescence and flower development [, ].  A. thaliana ZIM-like proteins (ZML) [].  A. thaliana PEAPOD1 and PEAPOD2 (PPD1 and PPD2) [].   
Probab=51.82  E-value=12  Score=25.85  Aligned_cols=14  Identities=36%  Similarity=0.664  Sum_probs=11.2

Q ss_pred             CCCCCCceEEEEcc
Q 023388          102 PPMSGEKLKIFYNP  115 (283)
Q Consensus       102 pP~sGe~L~lfyNp  115 (283)
                      |+....+|+||||=
T Consensus         1 ~~~~~~qLTIfY~G   14 (36)
T PF06200_consen    1 PSPETAQLTIFYGG   14 (36)
T ss_pred             CCCCCCcEEEEECC
Confidence            45677899999984


No 6  
>PF06830 Root_cap:  Root cap;  InterPro: IPR009646 The cells at the periphery of the root cap are continuously sloughed off from the root into the mucilage, and are thought to be programmed to die [].This family represents a conserved region approximately 60 residues in length within plant root cap proteins, which may be involved in the process.
Probab=45.26  E-value=10  Score=28.83  Aligned_cols=22  Identities=23%  Similarity=0.302  Sum_probs=16.9

Q ss_pred             ceeeecCCCCCccccCCchhhhh
Q 023388          126 FGIGFNGSFNQPFMCGGEPRAML  148 (283)
Q Consensus       126 fGiaFNGgFNQPIMCGGEPR~M~  148 (283)
                      |=--.+.|-+.||| |||++..+
T Consensus        23 yvn~vk~g~~MPvm-GG~~~y~t   44 (57)
T PF06830_consen   23 YVNPVKVGVAMPVM-GGEDKYRT   44 (57)
T ss_pred             cccccccCCCCccc-cCCcccee
Confidence            33346788899999 99998654


No 7  
>PF14524 Wzt_C:  Wzt C-terminal domain; PDB: 2R5O_B.
Probab=43.77  E-value=32  Score=25.71  Aligned_cols=78  Identities=19%  Similarity=0.214  Sum_probs=48.4

Q ss_pred             ceEeEecCCCCC---CCCCceEEEEccccCCCCCCCcceeeecCCCCCccccCCchhhhhhhhhCCCCCCceEEEeeecc
Q 023388           92 PVYWKTMNGLPP---MSGEKLKIFYNPYAKKLLPNEDFGIGFNGSFNQPFMCGGEPRAMLRKNRGQNDSPFYTIQICVPK  168 (283)
Q Consensus        92 pVyWkt~nGlpP---~sGe~L~lfyNp~as~l~PNe~fGiaFNGgFNQPIMCGGEPR~M~~k~RGkad~PiYtI~I~vPk  168 (283)
                      -|.....+|.+-   .+||.++|-+.=.+.+-.++-.+|+.+-.-..|+|+.--. ..+. ..=.....=.|++++.+|+
T Consensus        17 ~v~i~~~~g~~~~~~~~ge~~~i~i~~~~~~~i~~~~~~~~i~~~~g~~v~~~~t-~~~~-~~~~~~~~g~~~~~~~i~~   94 (142)
T PF14524_consen   17 SVRILDSDGEPTSSFESGEPIRIRIDYEVNEDIDDPVFGFAIRDSDGQRVFGTNT-YDSG-FPIPLSEGGTYEVTFTIPK   94 (142)
T ss_dssp             EEEEEETTEES-SSEETTSEEEEEEEEEESS-EEEEEEEEEEEETT--EEEEEEH-HHHT---EEE-TT-EEEEEEEEE-
T ss_pred             EEEEEeCCCCEeeEEeCCCEEEEEEEEEECCCCCccEEEEEEEcCCCCEEEEECc-cccC-ccccccCCCEEEEEEEEcC
Confidence            355666677766   3799999999888888889999999999988898875222 2221 1111111557889999998


Q ss_pred             ceee
Q 023388          169 HAIN  172 (283)
Q Consensus       169 Ha~~  172 (283)
                      + |+
T Consensus        95 ~-L~   97 (142)
T PF14524_consen   95 P-LN   97 (142)
T ss_dssp             --B-
T ss_pred             c-cC
Confidence            8 54


No 8  
>smart00809 Alpha_adaptinC2 Adaptin C-terminal domain. Adaptins are components of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. Gamma-adaptin is a subunit of the golgi adaptor. Alpha adaptin is a heterotetramer that regulates clathrin-bud formation. The carboxyl-terminal appendage of the alpha subunit regulates translocation of endocytic accessory proteins to the bud site. This Ig-fold domain is found in alpha, beta and gamma adaptins and consists of a beta-sandwich containing 7 strands in 2 beta-sheets in a greek-key topology PUBMED:10430869, PUBMED:12176391. The adaptor appendage contains an additional N-terminal strand.
Probab=38.76  E-value=77  Score=23.44  Aligned_cols=37  Identities=16%  Similarity=0.212  Sum_probs=28.5

Q ss_pred             EeeeccceeeEEEEeecCCCCCCc-eeEEEecCccccc
Q 023388          163 QICVPKHAINLIFSFTNGVEWDGP-YRIKFLVPRAWRN  199 (283)
Q Consensus       163 ~I~vPkHa~~LiFSFTnG~~WDGp-Y~L~f~VP~~~~n  199 (283)
                      +|.-..+.+.+...|+|-.+|+=- +.+++.|||.|+-
T Consensus        12 ~~~~~~~~~~i~~~~~N~s~~~it~f~~~~avpk~~~l   49 (104)
T smart00809       12 KFERRPGLIRITLTFTNKSPSPITNFSFQAAVPKSLKL   49 (104)
T ss_pred             EEEcCCCeEEEEEEEEeCCCCeeeeEEEEEEcccceEE
Confidence            333345778899999999888743 8899999997763


No 9  
>cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase. Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain. These enzymes attach Glu or Gln, respectively, to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers.  Archaea, cellular organelles, and some bacteria lack GlnRS.  In these cases, the "non-discriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme. The discriminating form of GluRS differs from GlnRS and the non-discriminating form of GluRS in their C-terminal anti-codon bind
Probab=37.88  E-value=32  Score=31.12  Aligned_cols=28  Identities=39%  Similarity=0.998  Sum_probs=19.5

Q ss_pred             CCCCCC-ceeEEEecCcccccCChhhhhhhHHHhhhccC
Q 023388          180 GVEWDG-PYRIKFLVPRAWRNKPMDFFNKGLADQLSKDG  217 (283)
Q Consensus       180 G~~WDG-pY~L~f~VP~~~~nkP~~fFneGLa~eLs~eG  217 (283)
                      |.+||+ ||.         |-.=.+.+-+ .+++|-++|
T Consensus        64 Gl~wd~~~~~---------QS~r~~~y~~-~~~~L~~~g   92 (230)
T cd00418          64 GLDWDEGPYR---------QSDRFDLYRA-YAEELIKKG   92 (230)
T ss_pred             CCCCCCCeee---------hhcCHHHHHH-HHHHHHHcC
Confidence            778998 653         5555666655 567888888


No 10 
>cd01514 Elongation_Factor_C Elongation factor G C-terminus. This domain includes the carboxyl terminal regions of elongation factors (EFs) bacterial EF-G, eukaryotic and archeal EF-2 and eukaryotic mitochondrial mtEFG1s and mtEFG2s. This group also includes proteins similar to the ribosomal protection proteins Tet(M) and Tet(O), BipA, LepA and, spliceosomal proteins: human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and yeast counterpart Snu114p.  This domain adopts a ferredoxin-like fold consisting of an alpha-beta sandwich with anti-parallel beta-sheets, resembling the topology of domain III found in the elongation factors EF-G and eukaryotic EF-2, with which it forms the C-terminal block. The two domains however are not superimposable and domain III lacks some of the characteristics of this domain.  EF-2/EF-G in complex with GTP, promotes the translocation step of translation. During translocation the peptidyl-tRNA is moved from the A site to the P site, the
Probab=36.03  E-value=11  Score=27.11  Aligned_cols=39  Identities=21%  Similarity=0.330  Sum_probs=25.0

Q ss_pred             CCceEEEeeeccceeeEEEE--------eecCCCCC-CceeEEEecCc
Q 023388          157 SPFYTIQICVPKHAINLIFS--------FTNGVEWD-GPYRIKFLVPR  195 (283)
Q Consensus       157 ~PiYtI~I~vPkHa~~LiFS--------FTnG~~WD-GpY~L~f~VP~  195 (283)
                      +|+|.+.|.+|..++.-+++        +.+-..++ +=+.|+..+|-
T Consensus         1 EPi~~~~I~~p~~~~g~v~~~l~~rrg~v~~~~~~~~~~~~i~~~iP~   48 (79)
T cd01514           1 EPIMKVEITVPEEYLGAVIGDLSKRRGEILGMEPRGTGRVVIKAELPL   48 (79)
T ss_pred             CCEEEEEEEcCHHHHHHHHHHHHhcCCeeEeeEecCCCeEEEEEECCH
Confidence            58999999999665433222        12222333 56899999994


No 11 
>PF02883 Alpha_adaptinC2:  Adaptin C-terminal domain;  InterPro: IPR008152 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. These vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transport []. Clathrin coats contain both clathrin (acts as a scaffold) and adaptor complexes that link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric GGA (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) adaptors [, ]. AP (adaptor protein) complexes are found in coated vesicles and clathrin-coated pits. AP complexes connect cargo proteins and lipids to clathrin at vesicle budding sites, as well as binding accessory proteins that regulate coat assembly and disassembly (such as AP180, epsins and auxilin). There are different AP complexes in mammals. AP1 is responsible for the transport of lysosomal hydrolases between the TGN and endosomes []. AP2 associates with the plasma membrane and is responsible for endocytosis []. AP3 is responsible for protein trafficking to lysosomes and other related organelles []. AP4 is less well characterised. AP complexes are heterotetramers composed of two large subunits (adaptins), a medium subunit (mu) and a small subunit (sigma). For example, in AP1 these subunits are gamma-1-adaptin, beta-1-adaptin, mu-1 and sigma-1, while in AP2 they are alpha-adaptin, beta-2-adaptin, mu-2 and sigma-2. Each subunit has a specific function. Adaptins recognise and bind to clathrin through their hinge region (clathrin box), and recruit accessory proteins that modulate AP function through their C-terminal ear (appendage) domains. Mu recognises tyrosine-based sorting signals within the cytoplasmic domains of transmembrane cargo proteins []. One function of clathrin and AP2 complex-mediated endocytosis is to regulate the number of GABA(A) receptors available at the cell surface [].  GGAs (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) are a family of monomeric clathrin adaptor proteins that are conserved from yeasts to humans. GGAs regulate clathrin-mediated the transport of proteins (such as mannose 6-phosphate receptors) from the TGN to endosomes and lysosomes through interactions with TGN-sorting receptors, sometimes in conjunction with AP-1 [, ]. GGAs bind cargo, membranes, clathrin and accessory factors. GGA1, GGA2 and GGA3 all contain a domain homologous to the ear domain of gamma-adaptin. GGAs are composed of a single polypeptide with four domains: an N-terminal VHS (Vps27p/Hrs/Stam) domain, a GAT (GGA and Tom1) domain, a hinge region, and a C-terminal GAE (gamma-adaptin ear) domain. The VHS domain is responsible for endocytosis and signal transduction, recognising transmembrane cargo through the ACLL sequence in the cytoplasmic domains of sorting receptors []. The GAT domain (also found in Tom1 proteins) interacts with ARF (ADP-ribosylation factor) to regulate membrane trafficking [], and with ubiquitin for receptor sorting []. The hinge region contains a clathrin box for recognition and binding to clathrin, similar to that found in AP adaptins. The GAE domain is similar to the AP gamma-adaptin ear domain, and is responsible for the recruitment of accessory proteins that regulate clathrin-mediated endocytosis [].  This entry represents a beta-sandwich structural motif found in the appendage (ear) domain of alpha-, beta- and gamma-adaptin from AP clathrin adaptor complexes, and the GAE (gamma-adaptin ear) domain of GGA adaptor proteins. These domains have an immunoglobulin-like beta-sandwich fold containing 7 or 8 strands in 2 beta-sheets in a Greek key topology [, ]. Although these domains share a similar fold, there is little sequence identity between the alpha/beta-adaptins and gamma-adaptin/GAE. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030131 clathrin adaptor complex; PDB: 3MNM_B 3ZY7_B 1GYU_A 1GYW_B 2A7B_A 1GYV_A 2E9G_A 1E42_B 2G30_A 2IV9_B ....
Probab=35.95  E-value=94  Score=23.57  Aligned_cols=32  Identities=13%  Similarity=0.257  Sum_probs=24.4

Q ss_pred             ccceeeEEEEeecCCCCCCc-eeEEEecCcccc
Q 023388          167 PKHAINLIFSFTNGVEWDGP-YRIKFLVPRAWR  198 (283)
Q Consensus       167 PkHa~~LiFSFTnG~~WDGp-Y~L~f~VP~~~~  198 (283)
                      -.|.+.+.+.|+|-..++=- +.+++.|||.|+
T Consensus        22 ~~~~~~i~~~f~N~s~~~it~f~~q~avpk~~~   54 (115)
T PF02883_consen   22 NPNQGRIKLTFGNKSSQPITNFSFQAAVPKSFK   54 (115)
T ss_dssp             ETTEEEEEEEEEE-SSS-BEEEEEEEEEBTTSE
T ss_pred             CCCEEEEEEEEEECCCCCcceEEEEEEeccccE
Confidence            45788899999998777644 889999998775


No 12 
>PRK11385 putativi pili assembly chaperone; Provisional
Probab=35.76  E-value=35  Score=30.80  Aligned_cols=37  Identities=19%  Similarity=0.309  Sum_probs=28.5

Q ss_pred             CCCceEeEecCCCCCCCCC----------ceEEEEccccCCCCCCCc
Q 023388           89 GKAPVYWKTMNGLPPMSGE----------KLKIFYNPYAKKLLPNED  125 (283)
Q Consensus        89 G~apVyWkt~nGlpP~sGe----------~L~lfyNp~as~l~PNe~  125 (283)
                      -|-.+||=.-.++||...+          ++||||.|..-+..|++.
T Consensus       110 DRESlf~lnv~~IPp~~~~~n~L~iair~riKLFyRP~~L~~~~~~a  156 (236)
T PRK11385        110 DRETLFELSIASVPSGKVENQSVKVAMRSVFKLFWRPEGLPGDPLEA  156 (236)
T ss_pred             CceEEEEEEEEecCCCcCCCceEEEEEEeeEEEEEcccccCCChhhh
Confidence            3447999999999997532          389999999877666653


No 13 
>PF05773 RWD:  RWD domain;  InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO). ; GO: 0005515 protein binding; PDB: 2EBM_A 2EBK_A 2DAX_A 2DAW_A 2DAY_A 2DMF_A 1UKX_A 2YZ0_A.
Probab=33.92  E-value=96  Score=22.60  Aligned_cols=63  Identities=19%  Similarity=0.366  Sum_probs=42.9

Q ss_pred             hhCCCCCCceEEEe--------eeccceeeEEEEeecCCCCCCceeEEEecCcccccCChhhhhhhHHHhhh
Q 023388          151 NRGQNDSPFYTIQI--------CVPKHAINLIFSFTNGVEWDGPYRIKFLVPRAWRNKPMDFFNKGLADQLS  214 (283)
Q Consensus       151 ~RGkad~PiYtI~I--------~vPkHa~~LiFSFTnG~~WDGpY~L~f~VP~~~~nkP~~fFneGLa~eLs  214 (283)
                      ...+..++.|+|+|        .-..+.+.|.|.|+.+-- +-|=++.++.++.+++.=..-.++-|.+.+.
T Consensus        23 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~l~~~~p~~YP-~~~P~i~l~~~~~~~~~~~~~l~~~l~~~~~   93 (113)
T PF05773_consen   23 EIESKSPPSLEVKLDESSSSFESSSFPSVTLHFTLPPGYP-ESPPKISLESPKNSRNEQIEKLNKELEQIAE   93 (113)
T ss_dssp             SSTSSSSEEEEEEE--CEECCTTTTSEEEEEEEEE-SSTT-SS--EEEEEEESSSHCHHHHHHHHHHHHHHH
T ss_pred             ccccCCCCceeeeecccccccccccceeEEEEEeCCCcCC-CcCCEEEEEcCCCCCHHHHHHHHHHHHHHHH
Confidence            44566778899988        356778999999999888 8887888888888774444444555544443


No 14 
>PF10102 DUF2341:  Domain of unknown function (DUF2341);  InterPro: IPR018765 This domain of unknown function is found in various bacterial proteins, including MotA/TolQ/ExbB proton channels and other transport proteins.
Probab=31.52  E-value=56  Score=25.56  Aligned_cols=41  Identities=20%  Similarity=0.543  Sum_probs=30.5

Q ss_pred             CCchhhh-c-cCCCceEeEecCCCCCCCCCceEEEE-ccccCCCC
Q 023388           80 RPSWAMF-E-LGKAPVYWKTMNGLPPMSGEKLKIFY-NPYAKKLL  121 (283)
Q Consensus        80 lPsWa~F-E-lG~apVyWkt~nGlpP~sGe~L~lfy-Np~as~l~  121 (283)
                      ||-|-+. . .+.-.+.|--.+-+|+ ....+.|+| ||.|...-
T Consensus        16 L~ywIE~wd~~~~~A~iWVkvp~i~~-~~~~i~lyyGn~~a~~~s   59 (89)
T PF10102_consen   16 LPYWIESWDPTNEQALIWVKVPSIPA-GSTTIYLYYGNPSATSAS   59 (89)
T ss_pred             eEEEEEECCCCCCeEEEEEECCCCCC-CCcEEEEEECCCCCccCC
Confidence            7777655 2 3445788888888888 888999999 78776653


No 15 
>PRK10150 beta-D-glucuronidase; Provisional
Probab=29.09  E-value=41  Score=32.99  Aligned_cols=47  Identities=17%  Similarity=0.347  Sum_probs=28.9

Q ss_pred             EEeeeccceeeEEEEeecCCCCCCc--eeEEEecCcccccCChhhhhhhH
Q 023388          162 IQICVPKHAINLIFSFTNGVEWDGP--YRIKFLVPRAWRNKPMDFFNKGL  209 (283)
Q Consensus       162 I~I~vPkHa~~LiFSFTnG~~WDGp--Y~L~f~VP~~~~nkP~~fFneGL  209 (283)
                      +.|.||-+- +....-..-.++.|.  |+-+|.||+.|++|-+..-=||+
T Consensus        43 ~~i~vP~~~-~~~~~~~~~~~~~G~~WYrr~f~lp~~~~gk~v~L~Fegv   91 (604)
T PRK10150         43 RAMAVPGSF-NDQFADADIRNYVGDVWYQREVFIPKGWAGQRIVLRFGSV   91 (604)
T ss_pred             cEecCCCch-hhccccccccCCcccEEEEEEEECCcccCCCEEEEEECcc
Confidence            567788653 222211112234555  99999999999998765444554


No 16 
>PRK15195 fimbrial chaperone protein FimC; Provisional
Probab=25.79  E-value=64  Score=28.80  Aligned_cols=35  Identities=23%  Similarity=0.723  Sum_probs=25.8

Q ss_pred             CCceEeEecCCCCCCCCC--------------ceEEEEccccCCCCCCC
Q 023388           90 KAPVYWKTMNGLPPMSGE--------------KLKIFYNPYAKKLLPNE  124 (283)
Q Consensus        90 ~apVyWkt~nGlpP~sGe--------------~L~lfyNp~as~l~PNe  124 (283)
                      |-.+||=.-..+||...+              .+||||.|..-+-.|++
T Consensus       103 rESlf~Lnv~eIP~~~~~~~~~~n~l~iair~~iKlFyRP~~l~~~~~~  151 (229)
T PRK15195        103 RESLFWMNVKAIPSVDKNALEGRNVLQLAILSRIKLFVRPINLQELPEE  151 (229)
T ss_pred             eeEEEEEEeeecCCCCcccccccceEEEEEEeEEEEEEcccccCCChhh
Confidence            446999999999995321              38999999976554443


No 17 
>PRK15188 fimbrial chaperone protein BcfB; Provisional
Probab=24.81  E-value=72  Score=28.79  Aligned_cols=37  Identities=16%  Similarity=0.421  Sum_probs=28.3

Q ss_pred             CCCceEeEecCCCCCCCCC-------------ceEEEEccccCCCCCCCc
Q 023388           89 GKAPVYWKTMNGLPPMSGE-------------KLKIFYNPYAKKLLPNED  125 (283)
Q Consensus        89 G~apVyWkt~nGlpP~sGe-------------~L~lfyNp~as~l~PNe~  125 (283)
                      -|-.+||=...++||..-.             .+||||-|..-+..+++.
T Consensus       104 DRESlf~lnv~~IP~~~~~~~~~n~l~ia~r~~IKLFyRP~~l~~~~~~a  153 (228)
T PRK15188        104 DRESVFYLNSKAIPSVDKNKLTGNSLQIATQSVIKLFIRPKNLAEAPAHA  153 (228)
T ss_pred             CceEEEEEEEEecCCCCccccccceEEEEEeeeEEEEECCccCCCChhhh
Confidence            3447999999999996421             389999999877666654


No 18 
>PF01630 Glyco_hydro_56:  Hyaluronidase;  InterPro: IPR018155 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 56 GH56 from CAZY comprises enzymes with only one known activity; hyaluronidase 3.2.1.35 from EC. The venom of Apis mellifera (Honeybee) contains several biologically-active peptides and two enzymes, one of which is a hyaluronidase []. The amino acid sequence of bee venom hyaluronidase contains 349 amino acids, and includes four cysteines and a number of potential glycosylation sites []. The sequence shows a high degree of similarity to PH-20, a membrane protein of mammalian sperm involved in sperm-egg adhesion, supporting the view that hyaluronidases play a role in fertilisation []. PH-20 is required for sperm adhesion to the egg zona pellucida; it is located on both the sperm plasma membrane and acrosomal membrane []. The amino acid sequence of the mature protein contains 468 amino acids, and includes six potential N-linked glycosylation sites and twelve cysteines, eight of which are tightly clustered near the C terminus [].; GO: 0004415 hyalurononglucosaminidase activity, 0005975 carbohydrate metabolic process; PDB: 1FCQ_A 1FCV_A 1FCU_A 2J88_A 2PE4_A 2ATM_A.
Probab=24.74  E-value=48  Score=32.04  Aligned_cols=33  Identities=27%  Similarity=0.487  Sum_probs=20.4

Q ss_pred             CCCCceEEEEccccCCCCCCCcceeeecCCCCC
Q 023388          104 MSGEKLKIFYNPYAKKLLPNEDFGIGFNGSFNQ  136 (283)
Q Consensus       104 ~sGe~L~lfyNp~as~l~PNe~fGiaFNGgFNQ  136 (283)
                      -.||.++|||.+.--.--==++-|..+|||.=|
T Consensus        44 f~G~~itIfY~~~lG~yP~~~~~~~~~NGGlPQ   76 (337)
T PF01630_consen   44 FRGQNITIFYEPRLGLYPYYDEQGKPVNGGLPQ   76 (337)
T ss_dssp             SSSSSEEEEESTSSST--EEEETSEEETTSSGG
T ss_pred             ccCCeEEEEeCCCCCCcceECCCCCeecCCCCC
Confidence            369999999998332211112234888888765


No 19 
>PF05393 Hum_adeno_E3A:  Human adenovirus early E3A glycoprotein;  InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2.; GO: 0016021 integral to membrane
Probab=24.57  E-value=44  Score=27.73  Aligned_cols=30  Identities=37%  Similarity=0.602  Sum_probs=21.4

Q ss_pred             hhhhCCCCCCceEEEeee-cc--------ceeeEEEEee
Q 023388          149 RKNRGQNDSPFYTIQICV-PK--------HAINLIFSFT  178 (283)
Q Consensus       149 ~k~RGkad~PiYtI~I~v-Pk--------Ha~~LiFSFT  178 (283)
                      -|.|-|+.+|||.=-|-+ |+        -.-++.|||+
T Consensus        55 C~kRkrsRrPIYrPvI~~~P~~~~~~~~~GL~~~~fs~~   93 (94)
T PF05393_consen   55 CKKRKRSRRPIYRPVIGLEPQNLQIHRDDGLRNLLFSFQ   93 (94)
T ss_pred             HHHhhhccCCccccccccCCCcccccccCCcceeEEEee
Confidence            378999999999876663 22        2336788886


No 20 
>PF11619 P53_C:  Transcription factor P53 - C terminal domain;  InterPro: IPR024631 The p53 tumour suppressor [, , , , ] is a protein found in increased amounts in a wide variety of transformed cells. It is also detectable in many proliferating non-transformed cells, but it is undetectable or present at low levels in resting cells. It is frequently mutated or inactivated in many types of cancer. p53 seems to act as a tumour suppressor in some, but probably not all, tumour types. p53 has been implicated in cell cycle regulation, particularly in the monitoring of genomic DNA integrity prior to replication; for this reason it has been dubbed `guardian of the genome'.  p53 is a sequence-specific DNA-binding protein and transcription factor. The structure of p53 comprises 4 domains: an N-terminal transactivation domain; a central DNA-binding domain; an oligomerisation domain; and a C-terminal, basic, regulatory domain [, ]. The structure of the oligomerisation domain consists of a dimer of dimers, each dimer consisting of 2 anti-parallel alpha-helices and an anti-parallel beta-sheet. The sheets lie on opposite sides of the tetramer and the helices form an unusual 4-helix bundle [, ]. While the majority of p53 mutations found in human cancers are located in the DNA-binding domain, some are also found in the oligomerisation domain. This entry represents the C-terminal domain of Drosophila transcription factor p53. While the rest of the protein is quite conserved between the different transcription factors such as p53 and p73, the C-terminal domain is highly divergent. The Drosophila p53 structure is characterised by an additional N-terminal beta-strand and a C-terminal helix [].; PDB: 2RP4_B.
Probab=23.79  E-value=52  Score=26.12  Aligned_cols=13  Identities=38%  Similarity=0.866  Sum_probs=12.2

Q ss_pred             CCceeEEEecCcc
Q 023388          184 DGPYRIKFLVPRA  196 (283)
Q Consensus       184 DGpY~L~f~VP~~  196 (283)
                      ||.|+|.+.+|++
T Consensus        14 dGdYrL~itcp~K   26 (71)
T PF11619_consen   14 DGDYRLVITCPKK   26 (71)
T ss_dssp             TTCEEEEEEESSH
T ss_pred             CCceEEEEecCcH
Confidence            8999999999986


No 21 
>smart00216 VWD von Willebrand factor (vWF) type D domain. Von Willebrand factor contains several type D domains: D1 and D2 are present within the N-terminal propeptide whereas the remaining D domains are required for multimerisation.
Probab=23.49  E-value=92  Score=24.59  Aligned_cols=20  Identities=30%  Similarity=0.571  Sum_probs=16.7

Q ss_pred             CCCCCceeEEEecCcccccC
Q 023388          181 VEWDGPYRIKFLVPRAWRNK  200 (283)
Q Consensus       181 ~~WDGpY~L~f~VP~~~~nk  200 (283)
                      +.|||--.|+++||..|+|+
T Consensus       122 v~~dg~~~~~V~~~~~~~g~  141 (162)
T smart00216      122 VTFDGLTLLSVQLPSRYRGK  141 (162)
T ss_pred             EEECCCcEEEEEECHHHCCC
Confidence            35898777999999988887


No 22 
>PF00094 VWD:  von Willebrand factor type D domain;  InterPro: IPR001846 A family of growth regulators (originally called cef10, connective tissue growth factor, fisp-12, cyr61, or, alternatively, beta IG-M1 and beta IG-M2), all belong to immediate-early genes expressed after induction by growth factors or certain oncogenes. Sequence analysis of this family revealed the presence of four distinct modules. Each module has homologues in other extracellular mosaic proteins such as Von Willebrand factor, slit, thrombospondins, fibrillar collagens, IGF-binding proteins and mucins. Classification and analysis of these modules suggests the location of binding regions and, by analogy to better characterised modules in other proteins, sheds some light onto the structure of this new family []. The vWF domain is found in various plasma proteins: complement factors B, C2, CR3 and CR4; the integrins (I-domains); collagen types VI, VII, XII and XIV; and other extracellular proteins [, , ]. Although the majority of VWA-containing proteins are extracellular, the most ancient ones present in all eukaryotes are all intracellular proteins involved in functions such as transcription, DNA repair, ribosomal and membrane transport and the proteasome. A common feature appears to be involvement in multiprotein complexes. Proteins that incorporate vWF domains participate in numerous biological events (e.g. cell adhesion, migration, homing, pattern formation, and signal transduction), involving interaction with a large array of ligands []. A number of human diseases arise from mutations in VWA domains. Secondary structure prediction from 75 aligned vWF sequences has revealed a largely alternating sequence of alpha-helices and beta-strands []. One of the functions of von Willebrand factor (vWF) is to serve as a carrier of clotting factor VIII (FVIII). The native conformation of the D' domain of vWF is not only required for factor VIII (FVIII) binding but also for normal multimerisation and optimal secretion. The interaction between blood clotting factor VIII and VWF is necessary for normal survival of blood clotting factor VIII in blood circulation. The VWFD domain is a highly structured region, in which the first conserved Cys has been found to form a disulphide bridge with the second conserved one [].
Probab=21.64  E-value=1.5e+02  Score=22.57  Aligned_cols=32  Identities=28%  Similarity=0.507  Sum_probs=23.3

Q ss_pred             ceeeEEEEeecCC--CCCCceeEEEecCcccccC
Q 023388          169 HAINLIFSFTNGV--EWDGPYRIKFLVPRAWRNK  200 (283)
Q Consensus       169 Ha~~LiFSFTnG~--~WDGpY~L~f~VP~~~~nk  200 (283)
                      +-+.+.++..-++  .|||-..+.+.+|..|+++
T Consensus       104 ~~~~v~~~~~~~v~~~~~~~~~~~v~~~~~~~g~  137 (159)
T PF00094_consen  104 GFVVVVFSSGVRVQVNWDGNMSVYVSVPPWYKGK  137 (159)
T ss_pred             ccEEEEEecCCeEEEEEecccccccccccccccc
Confidence            4344445444454  6899889999999999887


No 23 
>cd03713 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G.  Included in this group is the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2) proteins. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. In bacteria this translocation step is catalyzed by EF-G_GTP, which is hydrolyzed to provide
Probab=21.54  E-value=32  Score=24.74  Aligned_cols=36  Identities=25%  Similarity=0.369  Sum_probs=23.5

Q ss_pred             CCceEEEeeeccceee-----------EEEEeecCCCCCCceeEEEecCc
Q 023388          157 SPFYTIQICVPKHAIN-----------LIFSFTNGVEWDGPYRIKFLVPR  195 (283)
Q Consensus       157 ~PiYtI~I~vPkHa~~-----------LiFSFTnG~~WDGpY~L~f~VP~  195 (283)
                      .|+|.+.|.+|...+.           -+.+...   +++-..++..+|-
T Consensus         1 EPi~~~~I~~p~~~~g~v~~~l~~rrg~i~~~~~---~~~~~~i~~~iP~   47 (78)
T cd03713           1 EPIMKVEVTVPEEYMGDVIGDLSSRRGQILGTES---RGGWKVIKAEVPL   47 (78)
T ss_pred             CCEEEEEEEcCHHHHHHHHHHHHHcCCceEceec---cCCcEEEEEEcCH
Confidence            5899999999964432           1233332   3455789999984


No 24 
>PHA02739 hypothetical protein; Provisional
Probab=21.08  E-value=76  Score=26.92  Aligned_cols=26  Identities=23%  Similarity=0.547  Sum_probs=22.7

Q ss_pred             eEEEecCcccccCChhhhhhhHHHhh
Q 023388          188 RIKFLVPRAWRNKPMDFFNKGLADQL  213 (283)
Q Consensus       188 ~L~f~VP~~~~nkP~~fFneGLa~eL  213 (283)
                      -|+.-||+.|++.|..+--.=|.+++
T Consensus         2 ~lkiiVP~EW~~~p~~tL~~~L~~~i   27 (116)
T PHA02739          2 SLKLIVPNEWKVLPPATLQTELLRII   27 (116)
T ss_pred             cEEEEechhhhhCCHHHHHHHHHHHH
Confidence            37889999999999999888888777


No 25 
>TIGR01943 rnfA electron transport complex, RnfABCDGE type, A subunit. The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the A subunit.
Probab=21.02  E-value=50  Score=29.50  Aligned_cols=19  Identities=37%  Similarity=0.767  Sum_probs=16.6

Q ss_pred             ecCcccccCChhhhhhhHH
Q 023388          192 LVPRAWRNKPMDFFNKGLA  210 (283)
Q Consensus       192 ~VP~~~~nkP~~fFneGLa  210 (283)
                      +||+.||+.|+.|.--||-
T Consensus       161 ~vP~~~~G~pI~li~aglm  179 (190)
T TIGR01943       161 DVPKAFRGSPIALITAGLM  179 (190)
T ss_pred             CCCccccCcCHHHHHHHHH
Confidence            6999999999999887763


No 26 
>PF05725 FNIP:  FNIP Repeat;  InterPro: IPR008615 This repeat is approximately 22 residues long and is only found in Dictyostelium discoideum (Slime mould). It appears to be related to IPR001611 from INTERPRO. The alignment consists of two tandem repeats. It is termed the FNIP repeat after the pattern of conserved residues.
Probab=20.74  E-value=77  Score=21.20  Aligned_cols=22  Identities=36%  Similarity=0.560  Sum_probs=16.2

Q ss_pred             CCCCcceeeecCCCCCccccCC
Q 023388          121 LPNEDFGIGFNGSFNQPFMCGG  142 (283)
Q Consensus       121 ~PNe~fGiaFNGgFNQPIMCGG  142 (283)
                      .|+..=-+-|+..|||||.-|=
T Consensus        10 iP~~l~~L~~g~~fn~~i~~~~   31 (44)
T PF05725_consen   10 IPSSLKSLIFGSSFNQPIEPGS   31 (44)
T ss_pred             eCCCCeEEEECCccCccCCCCc
Confidence            3455556788999999998653


No 27 
>PRK15285 putative fimbrial chaperone protein StfD; Provisional
Probab=20.19  E-value=94  Score=28.44  Aligned_cols=36  Identities=22%  Similarity=0.617  Sum_probs=27.2

Q ss_pred             CCCceEeEecCCCCCCCCC----------ceEEEEccccCCCCCCC
Q 023388           89 GKAPVYWKTMNGLPPMSGE----------KLKIFYNPYAKKLLPNE  124 (283)
Q Consensus        89 G~apVyWkt~nGlpP~sGe----------~L~lfyNp~as~l~PNe  124 (283)
                      -|-.|||=..-+.||...+          ++||||-|++-+..+++
T Consensus       105 DRESlfwlnv~~IPp~~~~~n~L~iairtrIKLfYRP~~L~~~~~~  150 (250)
T PRK15285        105 DRETLFYYNVREIPPQSDKPNTLQIALQTRIKVFYRPQALSKIDMQ  150 (250)
T ss_pred             CceEEEEEEEEEcCCCCCCCcEEEEEeeeeeeEEECcccccCChhh
Confidence            3447999999999997532          48999999986555543


No 28 
>PF11763 DIPSY:  Cell-wall adhesin ligand-binding C-terminal;  InterPro: IPR021746  The DIPSY domain is characterised by the distinctive D*I*PSY motif at the very C terminus of yeast cell-wall glycoproteins. It appears not to be conserved in any other species, however. In fungi, cell adhesion is required for flocculation, mating and virulence, and is mediated by covalently bound cell wall proteins termed adhesins. Map4, an adhesin required for mating in Schizosaccharomyces pombe, is N-glycosylated and O-glycosylated, and is an endogenous substrate for the mannosyl transferase Oma4p. Map4 has a modular structure with an N-terminal signal peptide, a serine and threonine (S/T)-rich domain that includes nine repeats of 36 amino acids (rich in serine and threonine residues, but lacking glutamines), and a C-terminal DIPSY domain with no glycosyl-phosphatidyl inositol (GPI)-anchor signal. The N-terminal S/T-rich regions, are required for cell wall attachment, but the C-terminal DIPSY domain is required for agglutination and mating in liquid and solid media []. 
Probab=20.12  E-value=1.3e+02  Score=25.99  Aligned_cols=39  Identities=31%  Similarity=0.555  Sum_probs=25.9

Q ss_pred             CCceEEEeeec-cceeeEEEEeecCCCCCCceeEEEecCcccccCChh
Q 023388          157 SPFYTIQICVP-KHAINLIFSFTNGVEWDGPYRIKFLVPRAWRNKPMD  203 (283)
Q Consensus       157 ~PiYtI~I~vP-kHa~~LiFSFTnG~~WDGpY~L~f~VP~~~~nkP~~  203 (283)
                      .|+|++++-=| +|+.+++      ++=||-|+  |..+..=-+-|+.
T Consensus        47 rP~Y~v~~~D~~~~sf~I~------kn~dG~~~--Ft~~e~~~~ep~~   86 (123)
T PF11763_consen   47 RPIYRVYHDDPNKSSFNII------KNNDGTYQ--FTFVESSFSEPLD   86 (123)
T ss_pred             ccEEEEeecCCCcceEEEE------ecCCCcEE--EEEcccCCCCcEE
Confidence            59999999999 8888876      45567654  4444443344443


Done!