BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023409
         (282 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex
 pdb|3B2D|B Chain B, Crystal Structure Of Human Rp105MD-1 Complex
          Length = 603

 Score = 28.9 bits (63), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 6/63 (9%)

Query: 5  TEEELLWRASMAPRIHEYPFKRVPKVAFLFLTRGAVTLAPLW--EKFFHGHEGLYSIYVH 62
          T E L +  +  P IH   F R+  + FL LTR  +     W  E  F  H  L ++ + 
Sbjct: 31 TTEFLEFSFNFLPTIHNRTFSRLMNLTFLDLTRCQIN----WIHEDTFQSHHQLSTLVLT 86

Query: 63 SSP 65
           +P
Sbjct: 87 GNP 89


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.138    0.450 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,616,586
Number of Sequences: 62578
Number of extensions: 341229
Number of successful extensions: 765
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 762
Number of HSP's gapped (non-prelim): 5
length of query: 282
length of database: 14,973,337
effective HSP length: 98
effective length of query: 184
effective length of database: 8,840,693
effective search space: 1626687512
effective search space used: 1626687512
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)