Citrus Sinensis ID: 023422

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MGWYYRHSLLVLQNAVQRWNNHQKLKFVIHFGDIVDGFCPKDQSLEAVKKVVNEFEKFNGPAYHMIGNHCLYNLPRHMLLPLLKISSVDGRAYYDFSPTPEYRFVVLDGYDISAIGWPHNHPNTLEALKFLGEKNPNTEKNSPAGLVGLERRFLMFNGAVGKEQIKWLDAVLQDATKLNQKVVVCCHVPLDPGSASPEALLWNCNEVMDVIHRYNCVKVCLAGHDHQGGHSIDTHGIHHRVLEAALECPPGTDAFGHIDAYDDRLSLVGTGRMQSTDMCFTP
cccccccHHHHHHHHHHHHHHcccccEEEEcccccccccccHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccccccEEEcccccEEEEEEEcccccccccccccccHHHHHHHHccccccccccccccccccccccEEccccccHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccHHHHHHHHHHccccEEEEccccccccccccccccEEEEcccccccccccccEEEEEECccEEEEEECccccccEEEccc
MGWYYRHSLLVLQNAVQRWNNHQKLKFVIHFGDIVDGFCPKDQSLEAVKKVVNEFEKFNGPAYHMIGNHCLYNLPRHMLLPLLKISSVDGRAYYDFSPTPEYRFVVLDGYDISAIGWPHNHPNTLEALKFLGEKNPNTEKNSPAGLVGLERRFLMFNGAVGKEQIKWLDAVLQDATKLNQKVVVCCHVPLDPGSASPEALLWNCNEVMDVIHRYNCVKVCLAGHDHQGGHSIDTHGIHHRVLEAALECPPGTDAFGHIDAYDDRLSLVGTGRMQSTDMCFT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWYYRHSLLVLQNAVQRWNNHQKLKFVIHFGDIVDGFCPKDQSLEAVKKVVNEFEKFNGPAYHMIGNHCLYNLPRHMLLPLLKISSVDGRAYYDFSPTPEYRFVVLDGYDISAIGWPHNHPNTLEALKFLGEKNPNTEKNSPAGLVGLERRFLMFNGAVGKEQIKWLDAVLQDATKLNQKVVVCCHVPLDPGSASPEALLWNCNEVMDVIHRYNCVKVCLAGHDHQGGHSIDTHGIHHRVLEAALECPPGTDAFGHIDAYDDRLSLVGTGRMQSTDMCFTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose.confidentQ9SB68
Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose.probableQ8H5F8
Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress.probableQ3LIE5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.1.-In phosphorous-containing anhydrides.probable
3.6.1.13ADP-ribose diphosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NXF, chain A
Confidence level:very confident
Coverage over the Query: 3-281
View the alignment between query and template
View the model in PyMOL