Citrus Sinensis ID: 023434


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MAESTAVAINGVDDQTTEDFFDPDQDGSNNKVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIEVSRLQHDLVTSMSEGDELGAEVAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERNVGLLEVREMEEKSKRVRVEEEMREKLDEKDREISGFKKKVDDLESELGNCKSEKNSAEKTVKEMDERILLWQKEIEEAEKVIAGLKDKTLDGVNGTARDVKLNGDGEEEDSRLNWQLPLAAVTAAAVVCVCYARCR
ccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcHHHHHHHHHHHHHHHHHHHccc
MAESTAVAIngvddqttedffdpdqdgsnnkvTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIEVSRLQHDLVTSMSEGDELGAEVAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERNVGLLEVREMEEKSKRVRVEEEMREKLDEKDREISGFKKKVDDLESElgnckseknSAEKTVKEMDERILLWQKEIEEAEKVIAGLkdktldgvngtardvklngdgeeedsrlnWQLPLAAVTAAAVVCVCYARCR
MAESTAVaingvddqttedffdpdqdgsnnkvteltkkveslelenkemkgtikkltieiegseedkRILESVAARAEELEIEVSRLQHDLVTSMSEGDELGAEVAELKRvlgekgvkleelerevdglkkekvesekkvrelernvgllevremeekskrvrveeemrekldekdreisgfkkkvddleselgnckseknsaektvKEMDERILLWQKEIEEAEKVIaglkdktldgvngtardvklngdgeeedsrlnWQLPLAAVTAAAVVCVCYARCR
MAESTAVAINGVDDQTTEDFFDPDQDGSNNKVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIEVSRLQHDLVTSMSEGDELGAEVAELKRvlgekgvkleelerevDGlkkekvesekkvrelerNVGLLevremeekskrvrveeemrekLDEKDREISGFKKKVDDLESELGNCKSEKNSAEKTVKEMDERILLWQKEIEEAEKVIAGLKDKTLDGVNGTARDVKLNGDGEEEDSRLNWQLPLaavtaaavvcvcyaRCR
********************************************************************************************************************************************************************************************************************RILLWQKEIEEAEKVIAGLKDKTLDGVN*****************RLNWQLPLAAVTAAAVVCVCYAR**
***********************************************************************************************************************************************************************************************************************************************************************PLAAVTAAAVVCVCYARCR
MAESTAVAINGVDDQTTEDFFDPDQDGSNNKVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIEVSRLQHDLVTSMSEGDELGAEVAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERNVGLLEVREMEEKSKRVRVEEEMREKLDEKDREISGFKKKVDDLESELGNCKSEKNSAEKTVKEMDERILLWQKEIEEAEKVIAGLKDKTLDGVNGTARDVKLNGDGEEEDSRLNWQLPLAAVTAAAVVCVCYARCR
*****AVAINGVDDQTTEDFFDPDQDGSNNKVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIEVSRLQHDLVTSMSEGDELGAEVAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERNVGLLEVREMEEKSKRVRVEEEMREKLDEKDREISGFKKKVDDLESELGNCKSEKNSAEKTVKEMDERILLWQKEIEEAEKVIAGLKDKTLDGVNGTARDVKLNGDGEEEDSRLNWQLPLAAVTAAAVVCVCYARCR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAESTAVAINGVDDQTTEDFFDPDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGDELGAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTLDGVNGTARDVKLNGDGEEEDSRLNWQLPLAAVTAAAVVCVCYARCR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
449450848330 PREDICTED: uncharacterized protein LOC10 0.897 0.766 0.447 3e-49
224085302303 predicted protein [Populus trichocarpa] 0.918 0.854 0.432 2e-46
255558740275 protein with unknown function [Ricinus c 0.868 0.890 0.406 1e-38
225446863327 PREDICTED: uncharacterized protein LOC10 0.957 0.825 0.371 2e-37
147816954 480 hypothetical protein VITISV_030011 [Viti 0.957 0.562 0.371 3e-37
297820720318 hypothetical protein ARALYDRAFT_486343 [ 0.939 0.833 0.398 2e-35
224062756303 predicted protein [Populus trichocarpa] 0.904 0.841 0.431 1e-34
357494325345 hypothetical protein MTR_5g091710 [Medic 0.953 0.779 0.373 4e-33
356553631313 PREDICTED: uncharacterized protein LOC10 0.964 0.869 0.377 6e-33
15221511323 tropomyosin-related protein [Arabidopsis 0.829 0.724 0.386 7e-33
>gi|449450848|ref|XP_004143174.1| PREDICTED: uncharacterized protein LOC101216888 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  201 bits (511), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 133/297 (44%), Positives = 188/297 (63%), Gaps = 44/297 (14%)

Query: 13  DDQTTEDFFDPDQDGSNNKVTELTKKVESLELE-------NKEMKGTIKKLTIEIEG--- 62
           DDQ  EDF+D DQ  ++ KV EL +++E LE E       N+++K  I+ L+ EIEG   
Sbjct: 15  DDQNPEDFYDVDQRENDAKVAELNQRIEVLEREKKKLVDENEQIKDRIEILSAEIEGLKS 74

Query: 63  ------------------SEEDKRILESVAARAEELEIEVSRLQHDLVTSMSEGDELGAE 104
                             +EE  ++LESVAARA ELE EV+RLQHDL+++M+  D+  AE
Sbjct: 75  EEGTLKERLKEMEKQVKSAEEGNKVLESVAARALELETEVARLQHDLISTMNGADDANAE 134

Query: 105 VAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERNVGLLEVREMEEKSKRVRV 164
           V  L++ LGEK V +  +E E++ LKK K E E+KVRELER VG+LEV+E+EEKSK+VRV
Sbjct: 135 VERLRKSLGEKAVNVTAVEEELEALKKAKAEGERKVRELERKVGVLEVKEIEEKSKKVRV 194

Query: 165 EEEMREKLDEKDREISGFKKKVDDLES-------ELGNCKSEK-------NSAEKTVKEM 210
           EEEMR++++EK+ EI+ FKK + DLES       EL     EK         +E+  K +
Sbjct: 195 EEEMRDRIEEKEMEITSFKKTIMDLESVITKNGLELDRWIKEKLKVEELLKESEEKTKMV 254

Query: 211 DERILLWQKEIEEAEKVIAGLKDKTLDGVNGTARDVKLNGDGEEEDSRLNWQLPLAA 267
           + +++  QKE+EEA KVI GLK+K ++ +NGTA ++K    G E++  LNW  P+ A
Sbjct: 255 ESKMVQLQKEVEEAHKVICGLKEKAVNALNGTAEELKSAFKGAEKELNLNW--PIIA 309




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224085302|ref|XP_002307541.1| predicted protein [Populus trichocarpa] gi|222856990|gb|EEE94537.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558740|ref|XP_002520394.1| protein with unknown function [Ricinus communis] gi|223540441|gb|EEF42010.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|225446863|ref|XP_002283816.1| PREDICTED: uncharacterized protein LOC100247157 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147816954|emb|CAN71058.1| hypothetical protein VITISV_030011 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297820720|ref|XP_002878243.1| hypothetical protein ARALYDRAFT_486343 [Arabidopsis lyrata subsp. lyrata] gi|297324081|gb|EFH54502.1| hypothetical protein ARALYDRAFT_486343 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224062756|ref|XP_002300884.1| predicted protein [Populus trichocarpa] gi|222842610|gb|EEE80157.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357494325|ref|XP_003617451.1| hypothetical protein MTR_5g091710 [Medicago truncatula] gi|355518786|gb|AET00410.1| hypothetical protein MTR_5g091710 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356553631|ref|XP_003545158.1| PREDICTED: uncharacterized protein LOC100814031 [Glycine max] Back     alignment and taxonomy information
>gi|15221511|ref|NP_172140.1| tropomyosin-related protein [Arabidopsis thaliana] gi|6692690|gb|AAF24824.1|AC007592_17 F12K11.14 [Arabidopsis thaliana] gi|332189881|gb|AEE28002.1| tropomyosin-related protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
TAIR|locus:2009215323 PMD2 "AT1G06530" [Arabidopsis 0.304 0.266 0.406 1.2e-22
TAIR|locus:2099114318 PMD1 "peroxisomal and mitochon 0.283 0.251 0.412 5.6e-15
DICTYBASE|DDB_G0288069 1082 DDB_G0288069 [Dictyostelium di 0.312 0.081 0.325 3.6e-05
UNIPROTKB|E2RDK6 979 SYCP1 "Uncharacterized protein 0.283 0.081 0.321 6.8e-05
MGI|MGI:1098230 2474 Cenpe "centromere protein E" [ 0.358 0.040 0.291 0.00012
UNIPROTKB|J9NX31 979 SYCP1 "Uncharacterized protein 0.265 0.076 0.329 0.00026
SGD|S000004300 911 IMH1 "Protein involved in vesi 0.301 0.093 0.260 0.00059
TAIR|locus:2145141853 AT5G52280 "AT5G52280" [Arabido 0.237 0.078 0.333 0.0008
TAIR|locus:2009215 PMD2 "AT1G06530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 185 (70.2 bits), Expect = 1.2e-22, Sum P(2) = 1.2e-22
 Identities = 35/86 (40%), Positives = 59/86 (68%)

Query:    24 DQDGSNNKVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIE 83
             D D  N K+  LT ++E L     + K  + ++  EI+ S+E++++LE++A+RA ELE E
Sbjct:    51 DNDAINRKIESLTAEIEELRGAESKAKRKMGEMEREIDKSDEERKVLEAIASRASELETE 110

Query:    84 VSRLQHDLVTSMSEGDELGAEVAELK 109
             V+RLQH+L+T+ +EG+E  AE  +L+
Sbjct:   111 VARLQHELITARTEGEEATAEAEKLR 136


GO:0005739 "mitochondrion" evidence=IDA
GO:0009536 "plastid" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0031307 "integral to mitochondrial outer membrane" evidence=IDA
GO:0007005 "mitochondrion organization" evidence=IMP
TAIR|locus:2099114 PMD1 "peroxisomal and mitochondrial division factor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288069 DDB_G0288069 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDK6 SYCP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1098230 Cenpe "centromere protein E" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9NX31 SYCP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
SGD|S000004300 IMH1 "Protein involved in vesicular transport" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TAIR|locus:2145141 AT5G52280 "AT5G52280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-07
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-05
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 1e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 1e-04
PRK05771 646 PRK05771, PRK05771, V-type ATP synthase subunit I; 1e-04
pfam05622 713 pfam05622, HOOK, HOOK protein 1e-04
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 1e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-04
pfam01576 859 pfam01576, Myosin_tail_1, Myosin tail 6e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 7e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-04
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 0.001
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 0.001
pfam10186307 pfam10186, Atg14, UV radiation resistance protein 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
COG0466 782 COG0466, Lon, ATP-dependent Lon protease, bacteria 0.004
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
 Score = 55.1 bits (133), Expect = 2e-08
 Identities = 51/225 (22%), Positives = 93/225 (41%), Gaps = 8/225 (3%)

Query: 12  VDDQTTEDFFDPDQDGSNNKVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILE 71
              +   +            +  L  +VE LE    ++   + +L  EIE  EE     E
Sbjct: 715 EQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAE 774

Query: 72  SVAARAEE----LEIEVSRLQHDLVTSMSEGDELGAEVAELKRVLGEKGVKLEELEREVD 127
              A AE     LE ++ +L+ +L       DEL AE+  L         +LE LER + 
Sbjct: 775 EELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIA 834

Query: 128 GLKKEKVESEKKVRELERNVGLLEVREMEEKSKRVRVEEEMREKLDEKDREISGFKKKVD 187
             ++   + E+++ EL  ++  L   E+EE  +     EE+  +L+    E +  ++ + 
Sbjct: 835 ATERRLEDLEEQIEELSEDIESLA-AEIEELEEL---IEELESELEALLNERASLEEALA 890

Query: 188 DLESELGNCKSEKNSAEKTVKEMDERILLWQKEIEEAEKVIAGLK 232
            L SEL     E    E    E+   +   ++++ + E  + GL+
Sbjct: 891 LLRSELEELSEELRELESKRSELRRELEELREKLAQLELRLEGLE 935


SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179

>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated Back     alignment and domain information
>gnl|CDD|218661 pfam05622, HOOK, HOOK protein Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|220623 pfam10186, Atg14, UV radiation resistance protein and autophagy-related subunit 14 Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
COG3883265 Uncharacterized protein conserved in bacteria [Fun 98.97
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 98.83
PRK11637 428 AmiB activator; Provisional 98.61
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 98.48
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 98.42
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.25
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 98.23
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 98.21
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.21
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.2
PRK02224 880 chromosome segregation protein; Provisional 98.15
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 98.08
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 98.07
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 98.02
PRK02224 880 chromosome segregation protein; Provisional 98.0
PHA02562 562 46 endonuclease subunit; Provisional 98.0
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.98
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 97.94
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.94
PRK03918 880 chromosome segregation protein; Provisional 97.9
PRK11637 428 AmiB activator; Provisional 97.87
PHA02562562 46 endonuclease subunit; Provisional 97.86
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.84
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 97.73
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 97.69
PRK04778569 septation ring formation regulator EzrA; Provision 97.67
KOG0996 1293 consensus Structural maintenance of chromosome pro 97.65
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 97.64
PRK01156 895 chromosome segregation protein; Provisional 97.63
PRK04778569 septation ring formation regulator EzrA; Provision 97.62
KOG1003205 consensus Actin filament-coating protein tropomyos 97.6
PRK03918 880 chromosome segregation protein; Provisional 97.56
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.48
PRK01156 895 chromosome segregation protein; Provisional 97.47
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.45
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.44
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.37
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 97.36
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 97.34
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 97.33
KOG0964 1200 consensus Structural maintenance of chromosome pro 97.3
KOG0996 1293 consensus Structural maintenance of chromosome pro 97.28
PRK09039343 hypothetical protein; Validated 97.22
KOG0979 1072 consensus Structural maintenance of chromosome pro 97.21
KOG0933 1174 consensus Structural maintenance of chromosome pro 97.19
PF00038312 Filament: Intermediate filament protein; InterPro: 97.17
PF05701522 WEMBL: Weak chloroplast movement under blue light; 97.13
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 97.11
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 97.1
KOG0971 1243 consensus Microtubule-associated protein dynactin 97.01
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 97.01
PRK04863 1486 mukB cell division protein MukB; Provisional 96.99
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.97
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 96.94
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 96.9
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 96.89
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 96.85
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.82
PF00038312 Filament: Intermediate filament protein; InterPro: 96.82
KOG0971 1243 consensus Microtubule-associated protein dynactin 96.82
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.79
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 96.79
COG4942420 Membrane-bound metallopeptidase [Cell division and 96.76
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 96.76
KOG0964 1200 consensus Structural maintenance of chromosome pro 96.76
COG3883265 Uncharacterized protein conserved in bacteria [Fun 96.71
PF05010207 TACC: Transforming acidic coiled-coil-containing p 96.69
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.68
COG5185 622 HEC1 Protein involved in chromosome segregation, i 96.66
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.66
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 96.59
PRK04863 1486 mukB cell division protein MukB; Provisional 96.58
KOG0933 1174 consensus Structural maintenance of chromosome pro 96.57
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.56
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.55
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.54
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.54
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 96.53
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 96.52
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 96.51
PRK09039343 hypothetical protein; Validated 96.49
KOG0018 1141 consensus Structural maintenance of chromosome pro 96.41
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 96.38
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 96.37
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 96.16
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 96.12
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 96.12
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 96.09
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 96.01
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.97
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 95.89
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 95.86
KOG0018 1141 consensus Structural maintenance of chromosome pro 95.86
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.78
COG4372 499 Uncharacterized protein conserved in bacteria with 95.73
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 95.6
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 95.51
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 95.49
PF14662193 CCDC155: Coiled-coil region of CCDC155 95.43
PF135141111 AAA_27: AAA domain 95.38
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.35
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 95.27
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.2
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 95.18
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 95.16
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 95.03
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 94.89
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 94.88
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 94.87
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 94.82
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.74
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 94.67
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 94.6
COG5185 622 HEC1 Protein involved in chromosome segregation, i 94.59
COG2433652 Uncharacterized conserved protein [Function unknow 94.55
PF14662193 CCDC155: Coiled-coil region of CCDC155 94.53
PF13870177 DUF4201: Domain of unknown function (DUF4201) 94.52
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 94.49
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 94.34
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 94.28
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 94.26
PF13166 712 AAA_13: AAA domain 94.24
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 94.09
KOG0963 629 consensus Transcription factor/CCAAT displacement 94.07
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 94.04
PF13166 712 AAA_13: AAA domain 93.85
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 93.83
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 93.73
PLN03229762 acetyl-coenzyme A carboxylase carboxyl transferase 93.68
COG4942420 Membrane-bound metallopeptidase [Cell division and 93.46
PF13863126 DUF4200: Domain of unknown function (DUF4200) 93.44
PF13851201 GAS: Growth-arrest specific micro-tubule binding 93.35
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 93.24
KOG0979 1072 consensus Structural maintenance of chromosome pro 93.16
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 93.16
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.16
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 93.15
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 93.15
PRK10869 553 recombination and repair protein; Provisional 93.0
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 92.97
PF13870177 DUF4201: Domain of unknown function (DUF4201) 92.97
PRK09343121 prefoldin subunit beta; Provisional 92.96
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 92.87
PF14992280 TMCO5: TMCO5 family 92.83
KOG1003205 consensus Actin filament-coating protein tropomyos 92.79
PLN02939 977 transferase, transferring glycosyl groups 92.72
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 92.68
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 92.67
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 92.67
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 92.59
COG2433652 Uncharacterized conserved protein [Function unknow 92.57
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 92.54
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 92.49
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 92.48
KOG0963 629 consensus Transcription factor/CCAAT displacement 92.47
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 92.47
KOG4809 654 consensus Rab6 GTPase-interacting protein involved 92.37
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 92.3
KOG3850455 consensus Predicted membrane protein [Function unk 92.29
COG4477570 EzrA Negative regulator of septation ring formatio 92.28
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 92.14
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 92.04
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 92.0
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 91.95
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 91.94
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 91.91
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 91.88
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 91.81
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 91.54
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 91.47
COG4372 499 Uncharacterized protein conserved in bacteria with 91.47
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 91.42
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 91.4
PF05911769 DUF869: Plant protein of unknown function (DUF869) 91.36
PF10186302 Atg14: UV radiation resistance protein and autopha 91.27
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.26
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 91.23
PF10186302 Atg14: UV radiation resistance protein and autopha 91.17
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 90.79
PF04582326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 90.78
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 90.63
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 90.54
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 90.53
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 90.5
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 90.3
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 90.18
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 90.07
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 89.9
KOG4809654 consensus Rab6 GTPase-interacting protein involved 89.7
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 89.59
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 89.45
PF15066527 CAGE1: Cancer-associated gene protein 1 family 89.4
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 89.23
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 89.03
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 89.01
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 88.94
KOG4673 961 consensus Transcription factor TMF, TATA element m 88.84
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 88.79
PF13863126 DUF4200: Domain of unknown function (DUF4200) 88.62
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 88.54
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 88.53
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 88.53
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 88.26
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 88.18
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 88.07
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 87.93
PRK1542279 septal ring assembly protein ZapB; Provisional 87.83
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 87.63
PF02994370 Transposase_22: L1 transposable element; InterPro: 87.6
PRK00888105 ftsB cell division protein FtsB; Reviewed 87.55
COG3206458 GumC Uncharacterized protein involved in exopolysa 87.52
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 87.51
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 87.25
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 87.22
PF04912388 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit 87.18
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 87.16
KOG0972384 consensus Huntingtin interacting protein 1 (Hip1) 87.11
PF15450531 DUF4631: Domain of unknown function (DUF4631) 86.99
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 86.75
PRK10884206 SH3 domain-containing protein; Provisional 86.7
COG1730145 GIM5 Predicted prefoldin, molecular chaperone impl 86.48
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 86.36
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 86.22
PRK10929 1109 putative mechanosensitive channel protein; Provisi 86.17
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 86.11
KOG4673 961 consensus Transcription factor TMF, TATA element m 86.1
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 86.1
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 85.77
PF02994370 Transposase_22: L1 transposable element; InterPro: 85.56
PRK03947140 prefoldin subunit alpha; Reviewed 85.52
PRK10884206 SH3 domain-containing protein; Provisional 85.48
PF07851 330 TMPIT: TMPIT-like protein; InterPro: IPR012926 A n 85.47
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 85.38
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 85.27
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 85.26
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 85.02
TIGR02231 525 conserved hypothetical protein. This family consis 85.0
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 84.75
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 84.64
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 84.62
PF15294278 Leu_zip: Leucine zipper 84.43
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 84.41
PF09787 511 Golgin_A5: Golgin subfamily A member 5; InterPro: 84.27
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 84.17
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 84.07
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 83.88
KOG4677554 consensus Golgi integral membrane protein [Intrace 83.78
PF12777 344 MT: Microtubule-binding stalk of dynein motor; Int 83.76
PLN03229762 acetyl-coenzyme A carboxylase carboxyl transferase 83.58
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 83.4
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 83.36
COG4026290 Uncharacterized protein containing TOPRIM domain, 83.21
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 82.52
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 82.51
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 82.12
cd00890129 Prefoldin Prefoldin is a hexameric molecular chape 81.79
KOG3501114 consensus Molecular chaperone Prefoldin, subunit 1 81.74
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 81.42
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 81.29
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 81.11
KOG4302 660 consensus Microtubule-associated protein essential 80.86
PRK00409782 recombination and DNA strand exchange inhibitor pr 80.82
PF01920106 Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 80.62
PF15294278 Leu_zip: Leucine zipper 80.38
PF04582 326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 80.14
TIGR02231 525 conserved hypothetical protein. This family consis 80.12
COG4026290 Uncharacterized protein containing TOPRIM domain, 80.03
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
Probab=98.97  E-value=7e-08  Score=89.81  Aligned_cols=140  Identities=22%  Similarity=0.299  Sum_probs=112.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHH------------------HHh
Q 023434           31 KVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIEVSRLQH------------------DLV   92 (282)
Q Consensus        31 Ki~kL~~eI~~LE~Ei~elkekI~~le~eIe~lr~~~~~le~i~~r~~~L~ee~~~~q~------------------dl~   92 (282)
                      ++..+..++..+..++..++.+|..+..+|..++      ++|..|...|+.|+|.+|.                  ||+
T Consensus        60 qi~~~~~k~~~~~~~i~~~~~eik~l~~eI~~~~------~~I~~r~~~l~~raRAmq~nG~~t~Yidvil~SkSfsD~I  133 (265)
T COG3883          60 QIEEIQSKIDELQKEIDQSKAEIKKLQKEIAELK------ENIVERQELLKKRARAMQVNGTATSYIDVILNSKSFSDLI  133 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHcCChhHHHHHHHccCcHHHHH
Confidence            3334444444444444455555555555555555      6799999999999999998                  777


Q ss_pred             hhhcccchhHHHHHHHHHHHhhhhhhHHHHHHHHhhhHHHHHHHHHHHHHHHHHhhHHHHHHHHHhhhhhchHHHHHHhH
Q 023434           93 TSMSEGDELGAEVAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERNVGLLEVREMEEKSKRVRVEEEMREKL  172 (282)
Q Consensus        93 ~~~s~~~e~reEm~~LkseIee~e~eIeelEkeIe~LE~e~~~~ek~i~~LE~kl~ele~~~~~~~~~~gg~keelrekl  172 (282)
                      +|+++          |...++.....++.+..+-..|+.....+++++..|.....+++.           .-..|..++
T Consensus       134 sRvtA----------i~~iv~aDk~ile~qk~dk~~Le~kq~~l~~~~e~l~al~~e~e~-----------~~~~L~~qk  192 (265)
T COG3883         134 SRVTA----------ISVIVDADKKILEQQKEDKKSLEEKQAALEDKLETLVALQNELET-----------QLNSLNSQK  192 (265)
T ss_pred             HHHHH----------HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------HHHHHHHHH
Confidence            77777          999999999999999999999999999999999999999999965           668899999


Q ss_pred             HHHHHHHHHHHHhHHhHHHhhccch
Q 023434          173 DEKDREISGFKKKVDDLESELGNCK  197 (282)
Q Consensus       173 ~eke~ei~~Lk~~~e~L~~~l~~~k  197 (282)
                      .+++..+..+......+..+...++
T Consensus       193 ~e~~~l~~~~aa~~a~~~~e~a~l~  217 (265)
T COG3883         193 AEKNALIAALAAKEASALGEKAALE  217 (265)
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHHH
Confidence            9999999999988888888877666



>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF14992 TMCO5: TMCO5 family Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3850 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms] Back     alignment and domain information
>PF15450 DUF4631: Domain of unknown function (DUF4631) Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly Back     alignment and domain information
>KOG3501 consensus Molecular chaperone Prefoldin, subunit 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-17
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-16
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-10
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 5e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-11
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 3e-08
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 81.0 bits (200), Expect = 3e-17
 Identities = 48/214 (22%), Positives = 97/214 (45%), Gaps = 13/214 (6%)

Query: 30   NKVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIEVSRLQH 89
             ++ E     + L+LE     G IKK+  +I   E+    L       + LE  VS L  
Sbjct: 962  EQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLT---KERKLLEERVSDLTT 1018

Query: 90   DLVTSMSEGDELGAEVAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERNVGL 149
            +L     +   L     + + ++ E  V+L++ E+    L+K K + E +  +L   +  
Sbjct: 1019 NLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAE 1078

Query: 150  LEVREMEEKSKRVRVEEE---MREKLDEKDREISGFKKK-------VDDLESELGNCKSE 199
            L+ +  E K++  + EEE      +L+++  + +   KK       + DL+ +L + K+ 
Sbjct: 1079 LQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAA 1138

Query: 200  KNSAEKTVKEMDERILLWQKEIEEAEKVIAGLKD 233
            +N AEK  +++ E +   + E+E+     A  ++
Sbjct: 1139 RNKAEKQKRDLSEELEALKTELEDTLDTTATQQE 1172


>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 98.53
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 98.13
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.01
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.97
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.87
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.24
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.12
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.92
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.54
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.51
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 96.47
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 96.41
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.4
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 96.34
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 96.26
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.55
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 95.5
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.4
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.39
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 95.16
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 94.99
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 94.94
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 94.93
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 94.83
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 94.81
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 94.69
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 94.56
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 94.35
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 93.39
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 92.91
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 92.87
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 92.46
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 92.05
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 91.72
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 91.55
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 90.09
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 89.75
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 89.69
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 89.58
3cve_A72 Homer protein homolog 1; coiled coil, alternative 89.21
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 89.17
2v4h_A110 NF-kappa-B essential modulator; transcription, met 89.13
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 89.01
3l4q_C170 Phosphatidylinositol 3-kinase regulatory subunit b 88.02
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 87.96
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 87.95
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 86.56
2v4h_A110 NF-kappa-B essential modulator; transcription, met 86.53
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 86.07
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 85.17
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 84.11
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 84.05
3bas_A89 Myosin heavy chain, striated muscle/general contro 84.03
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 82.7
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 81.82
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 81.49
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 81.36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 81.04
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 80.94
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 80.83
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 80.37
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 80.22
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
Probab=98.53  E-value=8e-05  Score=63.64  Aligned_cols=57  Identities=23%  Similarity=0.242  Sum_probs=22.4

Q ss_pred             HHhhhhcccchhHHHHHHHHHHHhhhhhhHHHHHHHHhhhHHHHHHHHHHHHHHHHH
Q 023434           90 DLVTSMSEGDELGAEVAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERN  146 (282)
Q Consensus        90 dl~~~~s~~~e~reEm~~LkseIee~e~eIeelEkeIe~LE~e~~~~ek~i~~LE~k  146 (282)
                      .+.........+...+..+...+......+..+...+..+...+..+...+..+...
T Consensus        70 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~  126 (284)
T 1c1g_A           70 KLELAEKKATDAEADVASLNRRIQLFEEELDRAQERLATALQKLEEAEKAADESERG  126 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            333333333333333444444444444444444444444444443333333333333



>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 93.24
d1fxkc_133 Prefoldin alpha subunit {Archaeon Methanobacterium 87.33
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 86.3
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 84.55
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 82.99
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 82.85
>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: All alpha proteins
fold: Four-helical up-and-down bundle
superfamily: MW0975(SA0943)-like
family: MW0975(SA0943)-like
domain: Hypothetical protein MW0975 (SA0943)
species: Staphylococcus aureus [TaxId: 1280]
Probab=93.24  E-value=1.1  Score=32.88  Aligned_cols=25  Identities=12%  Similarity=0.179  Sum_probs=10.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHH
Q 023434          203 AEKTVKEMDERILLWQKEIEEAEKV  227 (282)
Q Consensus       203 ~e~~~~~~e~~I~~l~~e~~e~~~~  227 (282)
                      +...+..+...+..+...+..+...
T Consensus       149 l~~~~~~l~~~~~~~~~~~~~~~~~  173 (185)
T d2ap3a1         149 VNEKSKAIEQNYKKLKEVSDKYTKV  173 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3334444444444444444444433



>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure