Citrus Sinensis ID: 023434
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 282 | ||||||
| 449450848 | 330 | PREDICTED: uncharacterized protein LOC10 | 0.897 | 0.766 | 0.447 | 3e-49 | |
| 224085302 | 303 | predicted protein [Populus trichocarpa] | 0.918 | 0.854 | 0.432 | 2e-46 | |
| 255558740 | 275 | protein with unknown function [Ricinus c | 0.868 | 0.890 | 0.406 | 1e-38 | |
| 225446863 | 327 | PREDICTED: uncharacterized protein LOC10 | 0.957 | 0.825 | 0.371 | 2e-37 | |
| 147816954 | 480 | hypothetical protein VITISV_030011 [Viti | 0.957 | 0.562 | 0.371 | 3e-37 | |
| 297820720 | 318 | hypothetical protein ARALYDRAFT_486343 [ | 0.939 | 0.833 | 0.398 | 2e-35 | |
| 224062756 | 303 | predicted protein [Populus trichocarpa] | 0.904 | 0.841 | 0.431 | 1e-34 | |
| 357494325 | 345 | hypothetical protein MTR_5g091710 [Medic | 0.953 | 0.779 | 0.373 | 4e-33 | |
| 356553631 | 313 | PREDICTED: uncharacterized protein LOC10 | 0.964 | 0.869 | 0.377 | 6e-33 | |
| 15221511 | 323 | tropomyosin-related protein [Arabidopsis | 0.829 | 0.724 | 0.386 | 7e-33 |
| >gi|449450848|ref|XP_004143174.1| PREDICTED: uncharacterized protein LOC101216888 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 201 bits (511), Expect = 3e-49, Method: Compositional matrix adjust.
Identities = 133/297 (44%), Positives = 188/297 (63%), Gaps = 44/297 (14%)
Query: 13 DDQTTEDFFDPDQDGSNNKVTELTKKVESLELE-------NKEMKGTIKKLTIEIEG--- 62
DDQ EDF+D DQ ++ KV EL +++E LE E N+++K I+ L+ EIEG
Sbjct: 15 DDQNPEDFYDVDQRENDAKVAELNQRIEVLEREKKKLVDENEQIKDRIEILSAEIEGLKS 74
Query: 63 ------------------SEEDKRILESVAARAEELEIEVSRLQHDLVTSMSEGDELGAE 104
+EE ++LESVAARA ELE EV+RLQHDL+++M+ D+ AE
Sbjct: 75 EEGTLKERLKEMEKQVKSAEEGNKVLESVAARALELETEVARLQHDLISTMNGADDANAE 134
Query: 105 VAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERNVGLLEVREMEEKSKRVRV 164
V L++ LGEK V + +E E++ LKK K E E+KVRELER VG+LEV+E+EEKSK+VRV
Sbjct: 135 VERLRKSLGEKAVNVTAVEEELEALKKAKAEGERKVRELERKVGVLEVKEIEEKSKKVRV 194
Query: 165 EEEMREKLDEKDREISGFKKKVDDLES-------ELGNCKSEK-------NSAEKTVKEM 210
EEEMR++++EK+ EI+ FKK + DLES EL EK +E+ K +
Sbjct: 195 EEEMRDRIEEKEMEITSFKKTIMDLESVITKNGLELDRWIKEKLKVEELLKESEEKTKMV 254
Query: 211 DERILLWQKEIEEAEKVIAGLKDKTLDGVNGTARDVKLNGDGEEEDSRLNWQLPLAA 267
+ +++ QKE+EEA KVI GLK+K ++ +NGTA ++K G E++ LNW P+ A
Sbjct: 255 ESKMVQLQKEVEEAHKVICGLKEKAVNALNGTAEELKSAFKGAEKELNLNW--PIIA 309
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224085302|ref|XP_002307541.1| predicted protein [Populus trichocarpa] gi|222856990|gb|EEE94537.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255558740|ref|XP_002520394.1| protein with unknown function [Ricinus communis] gi|223540441|gb|EEF42010.1| protein with unknown function [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225446863|ref|XP_002283816.1| PREDICTED: uncharacterized protein LOC100247157 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147816954|emb|CAN71058.1| hypothetical protein VITISV_030011 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297820720|ref|XP_002878243.1| hypothetical protein ARALYDRAFT_486343 [Arabidopsis lyrata subsp. lyrata] gi|297324081|gb|EFH54502.1| hypothetical protein ARALYDRAFT_486343 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224062756|ref|XP_002300884.1| predicted protein [Populus trichocarpa] gi|222842610|gb|EEE80157.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357494325|ref|XP_003617451.1| hypothetical protein MTR_5g091710 [Medicago truncatula] gi|355518786|gb|AET00410.1| hypothetical protein MTR_5g091710 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356553631|ref|XP_003545158.1| PREDICTED: uncharacterized protein LOC100814031 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15221511|ref|NP_172140.1| tropomyosin-related protein [Arabidopsis thaliana] gi|6692690|gb|AAF24824.1|AC007592_17 F12K11.14 [Arabidopsis thaliana] gi|332189881|gb|AEE28002.1| tropomyosin-related protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 282 | ||||||
| TAIR|locus:2009215 | 323 | PMD2 "AT1G06530" [Arabidopsis | 0.304 | 0.266 | 0.406 | 1.2e-22 | |
| TAIR|locus:2099114 | 318 | PMD1 "peroxisomal and mitochon | 0.283 | 0.251 | 0.412 | 5.6e-15 | |
| DICTYBASE|DDB_G0288069 | 1082 | DDB_G0288069 [Dictyostelium di | 0.312 | 0.081 | 0.325 | 3.6e-05 | |
| UNIPROTKB|E2RDK6 | 979 | SYCP1 "Uncharacterized protein | 0.283 | 0.081 | 0.321 | 6.8e-05 | |
| MGI|MGI:1098230 | 2474 | Cenpe "centromere protein E" [ | 0.358 | 0.040 | 0.291 | 0.00012 | |
| UNIPROTKB|J9NX31 | 979 | SYCP1 "Uncharacterized protein | 0.265 | 0.076 | 0.329 | 0.00026 | |
| SGD|S000004300 | 911 | IMH1 "Protein involved in vesi | 0.301 | 0.093 | 0.260 | 0.00059 | |
| TAIR|locus:2145141 | 853 | AT5G52280 "AT5G52280" [Arabido | 0.237 | 0.078 | 0.333 | 0.0008 |
| TAIR|locus:2009215 PMD2 "AT1G06530" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 185 (70.2 bits), Expect = 1.2e-22, Sum P(2) = 1.2e-22
Identities = 35/86 (40%), Positives = 59/86 (68%)
Query: 24 DQDGSNNKVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIE 83
D D N K+ LT ++E L + K + ++ EI+ S+E++++LE++A+RA ELE E
Sbjct: 51 DNDAINRKIESLTAEIEELRGAESKAKRKMGEMEREIDKSDEERKVLEAIASRASELETE 110
Query: 84 VSRLQHDLVTSMSEGDELGAEVAELK 109
V+RLQH+L+T+ +EG+E AE +L+
Sbjct: 111 VARLQHELITARTEGEEATAEAEKLR 136
|
|
| TAIR|locus:2099114 PMD1 "peroxisomal and mitochondrial division factor 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0288069 DDB_G0288069 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RDK6 SYCP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1098230 Cenpe "centromere protein E" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NX31 SYCP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004300 IMH1 "Protein involved in vesicular transport" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145141 AT5G52280 "AT5G52280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 282 | |||
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-04 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 1e-04 | |
| pfam05622 | 713 | pfam05622, HOOK, HOOK protein | 1e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 1e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 6e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.001 | |
| pfam10186 | 307 | pfam10186, Atg14, UV radiation resistance protein | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG0466 | 782 | COG0466, Lon, ATP-dependent Lon protease, bacteria | 0.004 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Score = 55.1 bits (133), Expect = 2e-08
Identities = 51/225 (22%), Positives = 93/225 (41%), Gaps = 8/225 (3%)
Query: 12 VDDQTTEDFFDPDQDGSNNKVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILE 71
+ + + L +VE LE ++ + +L EIE EE E
Sbjct: 715 EQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAE 774
Query: 72 SVAARAEE----LEIEVSRLQHDLVTSMSEGDELGAEVAELKRVLGEKGVKLEELEREVD 127
A AE LE ++ +L+ +L DEL AE+ L +LE LER +
Sbjct: 775 EELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIA 834
Query: 128 GLKKEKVESEKKVRELERNVGLLEVREMEEKSKRVRVEEEMREKLDEKDREISGFKKKVD 187
++ + E+++ EL ++ L E+EE + EE+ +L+ E + ++ +
Sbjct: 835 ATERRLEDLEEQIEELSEDIESLA-AEIEELEEL---IEELESELEALLNERASLEEALA 890
Query: 188 DLESELGNCKSEKNSAEKTVKEMDERILLWQKEIEEAEKVIAGLK 232
L SEL E E E+ + ++++ + E + GL+
Sbjct: 891 LLRSELEELSEELRELESKRSELRRELEELREKLAQLELRLEGLE 935
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218661 pfam05622, HOOK, HOOK protein | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|220623 pfam10186, Atg14, UV radiation resistance protein and autophagy-related subunit 14 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 282 | |||
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 98.97 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.83 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.61 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.48 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.42 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.25 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.23 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.21 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.21 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.2 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.15 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.08 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.07 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.02 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.0 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.0 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.98 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.94 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.94 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.9 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.87 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.86 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.84 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.73 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.69 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.67 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.65 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.64 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.63 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.62 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 97.6 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.56 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.48 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.47 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.45 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.44 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.37 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.36 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 97.34 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.33 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 97.3 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.28 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.22 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 97.21 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.19 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.17 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.13 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.11 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 97.1 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.01 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.01 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.99 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.97 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.94 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 96.9 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.89 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 96.85 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.82 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.82 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.82 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.79 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.79 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.76 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.76 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.76 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 96.71 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 96.69 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.68 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.66 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.66 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.59 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.58 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.57 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.56 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.55 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.54 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.54 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.53 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 96.52 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.51 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.49 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.41 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 96.38 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 96.37 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 96.16 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 96.12 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.12 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.09 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 96.01 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 95.97 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.89 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 95.86 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 95.86 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 95.78 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 95.73 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.6 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 95.51 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 95.49 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.43 | |
| PF13514 | 1111 | AAA_27: AAA domain | 95.38 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.35 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 95.27 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 95.2 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 95.18 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.16 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 95.03 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 94.89 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 94.88 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 94.87 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 94.82 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.74 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.67 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.6 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.59 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 94.55 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 94.53 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 94.52 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 94.49 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.34 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.28 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.26 | |
| PF13166 | 712 | AAA_13: AAA domain | 94.24 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 94.09 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 94.07 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 94.04 | |
| PF13166 | 712 | AAA_13: AAA domain | 93.85 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 93.83 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 93.73 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 93.68 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 93.46 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 93.44 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 93.35 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 93.24 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 93.16 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 93.16 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 93.16 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 93.15 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 93.15 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 93.0 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 92.97 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 92.97 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 92.96 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 92.87 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 92.83 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 92.79 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 92.72 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 92.68 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 92.67 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 92.67 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 92.59 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 92.57 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 92.54 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 92.49 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 92.48 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 92.47 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.47 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 92.37 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 92.3 | |
| KOG3850 | 455 | consensus Predicted membrane protein [Function unk | 92.29 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 92.28 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 92.14 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.04 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 92.0 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 91.95 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 91.94 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 91.91 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 91.88 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 91.81 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 91.54 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 91.47 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 91.47 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 91.42 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 91.4 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 91.36 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 91.27 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 91.26 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 91.23 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 91.17 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 90.79 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 90.78 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 90.63 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 90.54 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 90.53 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 90.5 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 90.3 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 90.18 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 90.07 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 89.9 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 89.7 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 89.59 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 89.45 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 89.4 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 89.23 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 89.03 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 89.01 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 88.94 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 88.84 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 88.79 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 88.62 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 88.54 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 88.53 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 88.53 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 88.26 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 88.18 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 88.07 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 87.93 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 87.83 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 87.63 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 87.6 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 87.55 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 87.52 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 87.51 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 87.25 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 87.22 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 87.18 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 87.16 | |
| KOG0972 | 384 | consensus Huntingtin interacting protein 1 (Hip1) | 87.11 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 86.99 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 86.75 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 86.7 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 86.48 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 86.36 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 86.22 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 86.17 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 86.11 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 86.1 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 86.1 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 85.77 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 85.56 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 85.52 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 85.48 | |
| PF07851 | 330 | TMPIT: TMPIT-like protein; InterPro: IPR012926 A n | 85.47 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 85.38 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 85.27 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 85.26 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 85.02 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 85.0 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 84.75 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 84.64 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 84.62 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 84.43 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 84.41 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 84.27 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 84.17 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 84.07 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 83.88 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 83.78 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 83.76 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 83.58 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 83.4 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 83.36 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 83.21 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 82.52 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 82.51 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 82.12 | |
| cd00890 | 129 | Prefoldin Prefoldin is a hexameric molecular chape | 81.79 | |
| KOG3501 | 114 | consensus Molecular chaperone Prefoldin, subunit 1 | 81.74 | |
| PF04728 | 56 | LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 | 81.42 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 81.29 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 81.11 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 80.86 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 80.82 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 80.62 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 80.38 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 80.14 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 80.12 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 80.03 |
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
Probab=98.97 E-value=7e-08 Score=89.81 Aligned_cols=140 Identities=22% Similarity=0.299 Sum_probs=112.6
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHH------------------HHh
Q 023434 31 KVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIEVSRLQH------------------DLV 92 (282)
Q Consensus 31 Ki~kL~~eI~~LE~Ei~elkekI~~le~eIe~lr~~~~~le~i~~r~~~L~ee~~~~q~------------------dl~ 92 (282)
++..+..++..+..++..++.+|..+..+|..++ ++|..|...|+.|+|.+|. ||+
T Consensus 60 qi~~~~~k~~~~~~~i~~~~~eik~l~~eI~~~~------~~I~~r~~~l~~raRAmq~nG~~t~Yidvil~SkSfsD~I 133 (265)
T COG3883 60 QIEEIQSKIDELQKEIDQSKAEIKKLQKEIAELK------ENIVERQELLKKRARAMQVNGTATSYIDVILNSKSFSDLI 133 (265)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHcCChhHHHHHHHccCcHHHHH
Confidence 3334444444444444455555555555555555 6799999999999999998 777
Q ss_pred hhhcccchhHHHHHHHHHHHhhhhhhHHHHHHHHhhhHHHHHHHHHHHHHHHHHhhHHHHHHHHHhhhhhchHHHHHHhH
Q 023434 93 TSMSEGDELGAEVAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERNVGLLEVREMEEKSKRVRVEEEMREKL 172 (282)
Q Consensus 93 ~~~s~~~e~reEm~~LkseIee~e~eIeelEkeIe~LE~e~~~~ek~i~~LE~kl~ele~~~~~~~~~~gg~keelrekl 172 (282)
+|+++ |...++.....++.+..+-..|+.....+++++..|.....+++. .-..|..++
T Consensus 134 sRvtA----------i~~iv~aDk~ile~qk~dk~~Le~kq~~l~~~~e~l~al~~e~e~-----------~~~~L~~qk 192 (265)
T COG3883 134 SRVTA----------ISVIVDADKKILEQQKEDKKSLEEKQAALEDKLETLVALQNELET-----------QLNSLNSQK 192 (265)
T ss_pred HHHHH----------HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------HHHHHHHHH
Confidence 77777 999999999999999999999999999999999999999999965 668899999
Q ss_pred HHHHHHHHHHHHhHHhHHHhhccch
Q 023434 173 DEKDREISGFKKKVDDLESELGNCK 197 (282)
Q Consensus 173 ~eke~ei~~Lk~~~e~L~~~l~~~k 197 (282)
.+++..+..+......+..+...++
T Consensus 193 ~e~~~l~~~~aa~~a~~~~e~a~l~ 217 (265)
T COG3883 193 AEKNALIAALAAKEASALGEKAALE 217 (265)
T ss_pred HHHHHHHHHHHHHHHHhHHHHHHHH
Confidence 9999999999988888888877666
|
|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3850 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly | Back alignment and domain information |
|---|
| >KOG3501 consensus Molecular chaperone Prefoldin, subunit 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 282 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-17 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-11 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 3e-08 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 2e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 81.0 bits (200), Expect = 3e-17
Identities = 48/214 (22%), Positives = 97/214 (45%), Gaps = 13/214 (6%)
Query: 30 NKVTELTKKVESLELENKEMKGTIKKLTIEIEGSEEDKRILESVAARAEELEIEVSRLQH 89
++ E + L+LE G IKK+ +I E+ L + LE VS L
Sbjct: 962 EQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLT---KERKLLEERVSDLTT 1018
Query: 90 DLVTSMSEGDELGAEVAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERNVGL 149
+L + L + + ++ E V+L++ E+ L+K K + E + +L +
Sbjct: 1019 NLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAE 1078
Query: 150 LEVREMEEKSKRVRVEEE---MREKLDEKDREISGFKKK-------VDDLESELGNCKSE 199
L+ + E K++ + EEE +L+++ + + KK + DL+ +L + K+
Sbjct: 1079 LQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAA 1138
Query: 200 KNSAEKTVKEMDERILLWQKEIEEAEKVIAGLKD 233
+N AEK +++ E + + E+E+ A ++
Sbjct: 1139 RNKAEKQKRDLSEELEALKTELEDTLDTTATQQE 1172
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 282 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.53 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.13 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.01 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.97 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.87 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.24 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.12 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.92 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.54 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.51 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.47 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.41 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.4 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.34 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.26 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 95.55 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 95.5 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.4 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 95.39 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 95.16 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 94.99 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 94.94 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 94.93 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 94.83 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 94.81 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 94.69 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 94.56 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 94.35 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 93.39 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 92.91 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 92.87 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 92.46 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 92.05 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 91.72 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 91.55 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 90.09 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 89.75 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 89.69 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 89.58 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 89.21 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 89.17 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 89.13 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 89.01 | |
| 3l4q_C | 170 | Phosphatidylinositol 3-kinase regulatory subunit b | 88.02 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 87.96 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 87.95 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 86.56 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 86.53 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 86.07 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 85.17 | |
| 3iv1_A | 78 | Tumor susceptibility gene 101 protein; coiled_COIL | 84.11 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 84.05 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 84.03 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 82.7 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 81.82 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 81.49 | |
| 2lw1_A | 89 | ABC transporter ATP-binding protein UUP; ABC REG s | 81.36 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 81.04 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 80.94 | |
| 3iv1_A | 78 | Tumor susceptibility gene 101 protein; coiled_COIL | 80.83 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 80.37 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 80.22 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=98.53 E-value=8e-05 Score=63.64 Aligned_cols=57 Identities=23% Similarity=0.242 Sum_probs=22.4
Q ss_pred HHhhhhcccchhHHHHHHHHHHHhhhhhhHHHHHHHHhhhHHHHHHHHHHHHHHHHH
Q 023434 90 DLVTSMSEGDELGAEVAELKRVLGEKGVKLEELEREVDGLKKEKVESEKKVRELERN 146 (282)
Q Consensus 90 dl~~~~s~~~e~reEm~~LkseIee~e~eIeelEkeIe~LE~e~~~~ek~i~~LE~k 146 (282)
.+.........+...+..+...+......+..+...+..+...+..+...+..+...
T Consensus 70 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~ 126 (284)
T 1c1g_A 70 KLELAEKKATDAEADVASLNRRIQLFEEELDRAQERLATALQKLEEAEKAADESERG 126 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 333333333333333444444444444444444444444444443333333333333
|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 282 | |||
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 93.24 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 87.33 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 86.3 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 84.55 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 82.99 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 82.85 |
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Four-helical up-and-down bundle superfamily: MW0975(SA0943)-like family: MW0975(SA0943)-like domain: Hypothetical protein MW0975 (SA0943) species: Staphylococcus aureus [TaxId: 1280]
Probab=93.24 E-value=1.1 Score=32.88 Aligned_cols=25 Identities=12% Similarity=0.179 Sum_probs=10.5
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHH
Q 023434 203 AEKTVKEMDERILLWQKEIEEAEKV 227 (282)
Q Consensus 203 ~e~~~~~~e~~I~~l~~e~~e~~~~ 227 (282)
+...+..+...+..+...+..+...
T Consensus 149 l~~~~~~l~~~~~~~~~~~~~~~~~ 173 (185)
T d2ap3a1 149 VNEKSKAIEQNYKKLKEVSDKYTKV 173 (185)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 3334444444444444444444433
|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|