BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023456
         (282 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1RYY|A Chain A, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Y206a Mutant
 pdb|1RYY|B Chain B, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Y206a Mutant
 pdb|1RYY|C Chain C, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Y206a Mutant
 pdb|1RYY|D Chain D, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Y206a Mutant
 pdb|1RYY|E Chain E, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Y206a Mutant
 pdb|1RYY|F Chain F, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Y206a Mutant
 pdb|1RYY|G Chain G, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Y206a Mutant
 pdb|1RYY|H Chain H, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Y206a Mutant
          Length = 652

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 6/34 (17%)

Query: 130 YLSWEALCK------FTPLYYFDTSGYAFTYPLA 157
           Y SW ++C+       TPLY  D  G +FT+P A
Sbjct: 391 YRSWPSVCESNCTGGLTPLYLADGHGLSFTHPAA 424


>pdb|1NX9|A Chain A, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           S205a Mutant Complexed With Ampicillin
 pdb|1NX9|B Chain B, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           S205a Mutant Complexed With Ampicillin
 pdb|1NX9|C Chain C, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           S205a Mutant Complexed With Ampicillin
 pdb|1NX9|D Chain D, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           S205a Mutant Complexed With Ampicillin
          Length = 652

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 6/34 (17%)

Query: 130 YLSWEALCK------FTPLYYFDTSGYAFTYPLA 157
           Y SW ++C+       TPLY  D  G +FT+P A
Sbjct: 391 YRSWPSVCESNCTGGLTPLYLADGHGLSFTHPAA 424


>pdb|2B4K|A Chain A, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Complexed With Phenylglycine
 pdb|2B4K|B Chain B, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Complexed With Phenylglycine
 pdb|2B4K|C Chain C, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Complexed With Phenylglycine
 pdb|2B4K|D Chain D, Acetobacter Turbidans Alpha-Amino Acid Ester Hydrolase
           Complexed With Phenylglycine
 pdb|2B9V|A Chain A, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|B Chain B, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|C Chain C, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|D Chain D, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|E Chain E, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|F Chain F, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|G Chain G, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|H Chain H, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|I Chain I, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|J Chain J, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|K Chain K, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|L Chain L, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|M Chain M, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|N Chain N, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|O Chain O, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
 pdb|2B9V|P Chain P, Acetobacter Turbidans Alpha-amino Acid Ester Hydrolase
          Length = 652

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 6/34 (17%)

Query: 130 YLSWEALCK------FTPLYYFDTSGYAFTYPLA 157
           Y SW ++C+       TPLY  D  G +FT+P A
Sbjct: 391 YRSWPSVCESNCTGGLTPLYLADGHGLSFTHPAA 424


>pdb|4G59|C Chain C, Crystal Structure Of The Murine Cytomegalovirus Mhc-I
           Homolog M152 With Ligand Rae-1 Gamma
 pdb|4G59|D Chain D, Crystal Structure Of The Murine Cytomegalovirus Mhc-I
           Homolog M152 With Ligand Rae-1 Gamma
          Length = 321

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 171 PTISLDMISRVREGS--SMYNNNASIAQSNWLSQCKIV 206
           P +S D I+R  +GS  S+  +NA++ Q  W S C+ +
Sbjct: 138 PDVSEDDIARYGQGSGISILRDNAALLQKRWTSFCRKI 175


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.138    0.458 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,162,646
Number of Sequences: 62578
Number of extensions: 377433
Number of successful extensions: 923
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 922
Number of HSP's gapped (non-prelim): 5
length of query: 282
length of database: 14,973,337
effective HSP length: 98
effective length of query: 184
effective length of database: 8,840,693
effective search space: 1626687512
effective search space used: 1626687512
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)