Citrus Sinensis ID: 023496

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MGRKMEWAARADHMKGVPRKMLIMAVGAFAKVVANFLNTTSVHNADTLINLVQSRPQGVPLISVSNHMSTLDDPVMWGFRGFPTMDAELARWVLAAEDICFKNSILSYFFRVGKCIPITRGGGIYQEHMNEALERLSDGAWLHTFPEGKVSQEDAPIRQLKWGTASLIVRAPVTPIVLPIVHRGFEEVMPENFLFGRRPPVPLFNKRISIVVGEPIEFDIPKMRQMAISMSRDSLLPGMGWPSTTPCGLDEAAQRCLYSSISDKIRTVLESLRIFGKSVLK
ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHcccccccEEEEEccccccccHHHHHHccccccccHHHHHccccccccccccHHHHHHHcccEEEEcccccccHHHHHHHHHHHcccccEEECcccCECcccccccccccHHHHHHHccccccEEEEEEEcccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
*******AARADHMKGVPRKMLIMAVGAFAKVVANFLNTTSVHNADTLINLVQSRPQGVPLISVSNHMSTLDDPVMWGFRGFPTMDAELARWVLAAEDICFKNSILSYFFRVGKCIPITRGGGIYQEHMNEALERLSDGAWLHTFPEGKVSQEDAPIRQLKWGTASLIVRAPVTPIVLPIVHRGFEEVMPENFLFGRRPPVPLFNKRISIVVGEPIEFDIPKMRQMAISM********MGWPSTTPCGLDEAAQRCLYSSISDKIRTVLESLRIFG*****
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRKMEWAARADHMKGVPRKMLIMAVGAFAKVVANFLNTTSVHNADTLINLVQSRPQGVPLISVSNHMSTLDDPVMWGFRGFPTMDAELARWVLAAEDICFKNSILSYFFRVGKCIPITRGGGIYQEHMNEALERLSDGAWLHTFPEGKVSQEDAPIRQLKWGTASLIVRAPVTPIVLPIVHRGFEEVMPENFLFGRRPPVPLFNKRISIVVGEPIEFDIPKMRQMAISMSRDSLLPGMGWPSTTPCGLDEAAQRCLYSSISDKIRTVLESLRIFGKSVLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-acylphosphatidylethanolamine synthase Acyltransferase that catalyzes the N-acylation of phosphatidylethanolamine to form N-acylphosphatidylethanolamine (N-acyl-PE) (e.g. NAPEs containing C16:0, C16:1, C18:0, and C18:1). Mediates also the formation of acylphosphatidylglycerol (acyl-PG) from lysoglycerophospholipid by O-acylation. Uses acyl-CoA as acyl donors. Acylates 1-acyllysophosphatidylethanolamine (1-acyllyso-PE) and 1-acyllysophosphatidylglycerol (1-acyllyso-PG) at the sn-2-position.probableQ9ZV87

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IUQ, chain A
Confidence level:confident
Coverage over the Query: 26-226,247-274
View the alignment between query and template
View the model in PyMOL