Citrus Sinensis ID: 023521


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MRKRERENPCSVCGHYHKYEEGEVCGICGHRSASSAEKTTTLQVSAFPSEILPDFLYLGSYDNASRSGLLKTQGISRVLNTVPSCQNLYKNSFTYHCLEDDKILQFDDAIQFLEQCERDKACVLVHCMFGKNRSAAIVIAYLMKCKGWRLAQSHQWVKERRPSVNLTEDVHQQLQEYEQKIFGSVDGSNPTPLPALSAGMPSFSFGFPKGNNDPVPVPVPAPAPAPAFNTNFGATSIFAGRPSNVPTQGFTFGAGQTDISQTSLSGNIPNPNGSDIPMDSS
ccccccccccccccccEEEccccccccccccccccccccccccccccccEEccccEEEccHHHHccHHHHHHccccEEEEccccccccccccEEEECccccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
******E*PCSVCGHYHKYEEGEVCGICGHR**********LQVSAFPSEILPDFLYLGSYDNASRSGLLKTQGISRVLNTVPSCQNLYKNSFTYHCLEDDKILQFDDAIQFLEQCERDKACVLVHCMFGKNRSAAIVIAYLMKCKGWRLAQSHQWVKERRPSVNLTEDVHQQLQEYEQ******************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKRERENPCSVCGHYHKYEEGEVCGICGHRSASSAEKTTTLQVSAFPSEILPDFLYLGSYDNASRSGLLKTQGISRVLNTVPSCQNLYKNSFTYHCLEDDKILQFDDAIQFLEQCERDKACVLVHCMFGKNRSAAIVIAYLMKCKGWRLAQSHQWVKERRPSVNLTEDVHQQLQEYEQKIFGSVDGSNPTPLPALSAGMPSFSFGFPKGNNDPVPVPVPAPAPAPAFNTNFGATSIFAGRPSNVPTQGFTFGAGQTDISQTSLSGNIPNPNGSDIPMDSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein-tyrosine-phosphatase IBR5 Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Required for the transduction of auxin and abscisic acid (ABA) signaling pathways. Dephosphorylates and inactivates the MAP kinase MPK12.probableQ84JU4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.48Protein-tyrosine-phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OUD, chain A
Confidence level:very confident
Coverage over the Query: 42-188
View the alignment between query and template
View the model in PyMOL
Template: 1YWF, chain A
Confidence level:probable
Coverage over the Query: 33-158
View the alignment between query and template
View the model in PyMOL