Citrus Sinensis ID: 023531

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-

MVKGRNHHGAGVIRLRGEEKEKVKGHYSICAIGGMLSAGTAHLAITPLDVVKVNMQVHPIKYSSIASCYTNLLKEQGASAFWRGSAAKFFGYGAQGGCRFGLYEYFKSLYSSVLGDCSRSSVFFLSSASAEVFANVALCPFEAIKVQVQAQPHFAKGLADGIPKLYASEGIFGTKEDCSKTQQLGVTCIAGYAAGSFGSFISNPADNIVASLYNKKADSLMLAVKKIGLISLFTRSLPIRIMLVGPVVTLQWFFYDTIKVLSGLPTSGELAIEVEVVQNKE

cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHcHHHHHcccccccccEEccccHHHHHHHHHHHHHcccccccccccHHHHHcccc

*********************KVKGHYSICAIGGMLSAGTAHLAITPLDVVKVNMQVHPIKYSSIASCYTNLLKEQGASAFWRGSAAKFFGYGAQGGCRFGLYEYFKSLYSSVLGDCSRSSVFFLSSASAEVFANVALCPFEAIKVQVQAQPHFAKGLADGIPKLYASEGIFGTKEDCSKTQQLGVTCIAGYAAGSFGSFISNPADNIVASLYNKKADSLMLAVKKIGLISLFTRSLPIRIMLVGPVVTLQWFFYDTIKVLSGLPTS**************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitochondrial phosphate carrier protein 1, mitochondrial	Transport of phosphate groups from the cytosol to the mitochondrial matrix. Mediates salt stress tolerance through an ATP-dependent pathway and via modulation of the gibberellin metabolism.	probable	Q7DNC3
Mitochondrial phosphate carrier protein 2	Transport of phosphate groups from the cytosol to the mitochondrial matrix.	probable	P40035

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 30-266
View the alignment between query and template
View the model in PyMOL