Citrus Sinensis ID: 023539


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MGSGQWIMEKRSSLRNDSFSRDNDNVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQSNEVHIFGYARTKISDDELRNRIRGYLINDKSAPGQSEQVSEFLQLIKYVSGSYDTEEGFQLLDKEISAHESSKNSLEGSSRRLFYFALPPSVYPSVSRMIKKCCMNRSDLGGWTRIVVEKPFGKDLDSSEKLSAQIGELFEEPQIYRIDHYLGKELVQNLLVLRFANRMFLPLWNRDNIDNVQIVFREDFGTEGRGGYFDEYGYALQMRSNFLCTTSK
cccccccccccccccccccccccccccccccEEEEEEcccccccccccHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHHcccccccccccEEEEEccccccHHHHHHHHHHHcccccccccCEEEEECccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccccccccccccccEEEEEccccccccccccccccccHHHHHHHHHHHcccc
****************************TGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQSNEVHIFGYARTKISDDELRNRIRGYLIN********EQVSEFLQLIKYVSGSYDTEEGFQLLDKEISAHESSKNSLEGSSRRLFYFALPPSVYPSVSRMIKKCCMNRSDLGGWTRIVVEKPFGKDLDSSEKLSAQIGELFEEPQIYRIDHYLGKELVQNLLVLRFANRMFLPLWNRDNIDNVQIVFREDFGTEGRGGYFDEYGYALQMRSNFLCTT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSGQWIMEKRSSLRNDSFSRDNDNVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQSNEVHIFGYARTKISDDELRNRIRGYLINDKSAPGQSEQVSEFLQLIKYVSGSYDTEEGFQLLDKEISAHESSKNSLEGSSRRLFYFALPPSVYPSVSRMIKKCCMNRSDLGGWTRIVVEKPFGKDLDSSEKLSAQIGELFEEPQIYRIDHYLGKELVQNLLVLRFANRMFLPLWNRDNIDNVQIVFREDFGTEGRGGYFDEYGYALQMRSNFLCTTSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 2 Catalyzes the rate-limiting step of the oxidative pentose-phosphate pathway, which represents a route for the dissimilation of carbohydrates besides glycolysis. The main function of this enzyme is to provide reducing power (NADPH) and pentose phosphates for fatty acid and nucleic acid synthesis which are involved in membrane synthesis and cell division.probableQ9FJI5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable
1.1.1.49Glucose-6-phosphate dehydrogenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4E9I, chain A
Confidence level:very confident
Coverage over the Query: 25-280
View the alignment between query and template
View the model in PyMOL