Citrus Sinensis ID: 023567

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MAMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKRNWWFHCLKLSDENQSV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEcccccccccccccccHHHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHccccEEEcccccccccccHHHccHHHHHHHHccEEEEccccccccccccccccccccccccccccc
ccEEEccccccccccccccccEEccccccccccccccEEEccccccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEccHHHcccccccccHHHHHHHHHHHccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHccccEEEEcccccEccccHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccc
mamhvsgacfsvfsgsrvgnIRAVASEGFATVKTAEDkvklggsdlkvtklgvgawswgdtsywnnfqwdDRKMKAAKAAFDtsldngitffdtaevygsrasfgainsETLLGRFIKerkqrdpevEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWagiwgnegfidgLGDAVEQGLVKAvgvsnyseKRLRNAYEKLKKrgiplasnqvnysliyrkpeengvkAACDELGITLIAycpiaqgskprkrnwwfhCLKLSDENQSV
MAMHVSGACFsvfsgsrvgNIRAVASegfatvktaedkvklggsdlkvtklgvgawswgdTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVygsrasfgainsetLLGRFIKErkqrdpevevtvatkfaalpwrlGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKavgvsnysekrLRNAYEklkkrgiplasnqvnySLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKRNWWFHCLklsdenqsv
MAMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKRNWWFHCLKLSDENQSV
******GACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKRNWWFHCLKL*******
********CFSVFSGS****************KTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKRN***************
MAMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKER********VTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKRNWWFHCLKLSDENQSV
*AMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKR****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKRNWWFHCLKLSDENQSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query280 2.2.26 [Sep-21-2011]
Q94A68377 Uncharacterized oxidoredu yes no 0.853 0.633 0.804 1e-111
Q56Y42365 Pyridoxal reductase,chlor no no 0.739 0.567 0.417 7e-39
P77735324 Uncharacterized oxidoredu N/A no 0.75 0.648 0.311 1e-19
A2XRZ6 355 Probable aldo-keto reduct N/A no 0.721 0.569 0.309 4e-16
P63485323 Uncharacterized oxidoredu yes no 0.664 0.575 0.347 2e-15
P63484323 Uncharacterized oxidoredu yes no 0.664 0.575 0.347 2e-15
Q9P7U2351 Putative aryl-alcohol deh yes no 0.721 0.575 0.306 4e-15
Q3L181 337 Perakine reductase OS=Rau N/A no 0.714 0.593 0.301 4e-15
P80874331 General stress protein 69 yes no 0.696 0.589 0.295 9e-15
C6TBN2 346 Probable aldo-keto reduct no no 0.707 0.572 0.307 2e-14
>sp|Q94A68|Y1669_ARATH Uncharacterized oxidoreductase At1g06690, chloroplastic OS=Arabidopsis thaliana GN=At1g06690 PE=1 SV=1 Back     alignment and function desciption
 Score =  400 bits (1027), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 215/240 (89%), Gaps = 1/240 (0%)

Query: 21  IRAVAS-EGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKA 79
           +RAVAS +  A   + E KVKLGGSDLKVTKLG+G WSWGD SYWN+FQWDDRK+KAAK 
Sbjct: 30  VRAVASGDSVAPAISEESKVKLGGSDLKVTKLGIGVWSWGDNSYWNDFQWDDRKLKAAKG 89

Query: 80  AFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALP 139
           AFDTSLDNGI FFDTAEVYGS+ S GAI+SETLLGRFI+ERK+R P  EV+VATKFAALP
Sbjct: 90  AFDTSLDNGIDFFDTAEVYGSKFSLGAISSETLLGRFIRERKERYPGAEVSVATKFAALP 149

Query: 140 WRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSN 199
           WR GR+SV+ ALKDSL RL LSSV+LYQLHW G+WGNEG++DGLGDAVEQGLVKAVGVSN
Sbjct: 150 WRFGRESVVTALKDSLSRLELSSVDLYQLHWPGLWGNEGYLDGLGDAVEQGLVKAVGVSN 209

Query: 200 YSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGS 259
           YSEKRLR+AYE+LKKRGIPLASNQVNYSLIYR PE+ GVKAACDELG+TLIAY PIAQG+
Sbjct: 210 YSEKRLRDAYERLKKRGIPLASNQVNYSLIYRAPEQTGVKAACDELGVTLIAYSPIAQGA 269

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q56Y42|PLR1_ARATH Pyridoxal reductase,chloroplastic OS=Arabidopsis thaliana GN=PLR1 PE=1 SV=1 Back     alignment and function description
>sp|P77735|YAJO_ECOLI Uncharacterized oxidoreductase YajO OS=Escherichia coli (strain K12) GN=yajO PE=3 SV=2 Back     alignment and function description
>sp|A2XRZ6|AKR3_ORYSI Probable aldo-keto reductase 3 OS=Oryza sativa subsp. indica GN=H0813E03.4 PE=3 SV=1 Back     alignment and function description
>sp|P63485|Y2320_MYCBO Uncharacterized oxidoreductase Mb2320 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2320 PE=3 SV=1 Back     alignment and function description
>sp|P63484|Y2298_MYCTU Uncharacterized oxidoreductase Rv2298/MT2355 OS=Mycobacterium tuberculosis GN=Rv2298 PE=3 SV=1 Back     alignment and function description
>sp|Q9P7U2|YI7E_SCHPO Putative aryl-alcohol dehydrogenase C977.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.14c PE=1 SV=1 Back     alignment and function description
>sp|Q3L181|PERR_RAUSE Perakine reductase OS=Rauvolfia serpentina GN=PR PE=1 SV=1 Back     alignment and function description
>sp|P80874|GS69_BACSU General stress protein 69 OS=Bacillus subtilis (strain 168) GN=yhdN PE=1 SV=2 Back     alignment and function description
>sp|C6TBN2|AKR1_SOYBN Probable aldo-keto reductase 1 OS=Glycine max GN=AKR1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
225446767367 PREDICTED: uncharacterized oxidoreductas 0.925 0.705 0.841 1e-124
224066531372 predicted protein [Populus trichocarpa] 0.921 0.693 0.849 1e-123
224082608369 predicted protein [Populus trichocarpa] 0.917 0.696 0.849 1e-122
388498502367 unknown [Lotus japonicus] 0.921 0.702 0.798 1e-120
255561154369 aldo/keto reductase, putative [Ricinus c 0.925 0.701 0.804 1e-119
356567476368 PREDICTED: uncharacterized oxidoreductas 0.925 0.703 0.788 1e-118
255645632301 unknown [Glycine max] 0.925 0.860 0.788 1e-118
356526938368 PREDICTED: uncharacterized oxidoreductas 0.925 0.703 0.776 1e-117
224082610362 predicted protein [Populus trichocarpa] 0.917 0.709 0.775 1e-113
297848944377 aldo/keto reductase family protein [Arab 0.853 0.633 0.804 1e-110
>gi|225446767|ref|XP_002278419.1| PREDICTED: uncharacterized oxidoreductase At1g06690, chloroplastic [Vitis vinifera] gi|302143505|emb|CBI22066.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 218/259 (84%), Positives = 235/259 (90%)

Query: 1   MAMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGD 60
           MA++VS ACF  FS  RV  I+AVASEGFATVKT E+KVKLGGSDLKVTKLG+GAWSWGD
Sbjct: 1   MALYVSSACFCGFSQKRVERIKAVASEGFATVKTEEEKVKLGGSDLKVTKLGIGAWSWGD 60

Query: 61  TSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKER 120
           TSYWNNF+WDDRKMKAAK AFD S+D GIT FDTAEVYGSR SFGAINSETLLGRFIKER
Sbjct: 61  TSYWNNFEWDDRKMKAAKGAFDASIDVGITLFDTAEVYGSRFSFGAINSETLLGRFIKER 120

Query: 121 KQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFI 180
           K+++PEVEV VATKFAALPWR GRQSV+ ALKDSL RLGL SV+LYQLHW G+WGNEG+I
Sbjct: 121 KEKNPEVEVAVATKFAALPWRFGRQSVITALKDSLCRLGLLSVDLYQLHWPGVWGNEGYI 180

Query: 181 DGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKA 240
           DGLGDAVE GLVKAVGVSNYSEKRL  AYEKLKKRGIPLASNQVNYSL+YR PEENGVKA
Sbjct: 181 DGLGDAVEMGLVKAVGVSNYSEKRLLEAYEKLKKRGIPLASNQVNYSLLYRLPEENGVKA 240

Query: 241 ACDELGITLIAYCPIAQGS 259
           ACDELG+TLIAY PIAQG+
Sbjct: 241 ACDELGVTLIAYSPIAQGA 259

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224066531|ref|XP_002302125.1| predicted protein [Populus trichocarpa] gi|222843851|gb|EEE81398.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224082608|ref|XP_002306762.1| predicted protein [Populus trichocarpa] gi|222856211|gb|EEE93758.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388498502|gb|AFK37317.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255561154|ref|XP_002521589.1| aldo/keto reductase, putative [Ricinus communis] gi|223539267|gb|EEF40860.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356567476|ref|XP_003551945.1| PREDICTED: uncharacterized oxidoreductase At1g06690, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255645632|gb|ACU23310.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356526938|ref|XP_003532072.1| PREDICTED: uncharacterized oxidoreductase At1g06690, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|224082610|ref|XP_002306763.1| predicted protein [Populus trichocarpa] gi|222856212|gb|EEE93759.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297848944|ref|XP_002892353.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297338195|gb|EFH68612.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
TAIR|locus:2009120377 AT1G06690 "AT1G06690" [Arabido 0.853 0.633 0.804 1.3e-102
TAIR|locus:2168601365 PLR1 "AT5G53580" [Arabidopsis 0.760 0.583 0.431 1.3e-38
TIGR_CMR|DET_0217324 DET_0217 "oxidoreductase, aldo 0.732 0.632 0.352 3.3e-24
UNIPROTKB|P77735324 yajO [Escherichia coli K-12 (t 0.803 0.694 0.316 4.3e-22
TAIR|locus:2042124 384 AT2G27680 "AT2G27680" [Arabido 0.714 0.520 0.273 4.3e-17
UNIPROTKB|P63484323 MT2355 "Uncharacterized oxidor 0.678 0.588 0.348 6.1e-17
UNIPROTKB|Q0C2F5 344 HNE_1371 "Dimethylsulfoxide re 0.732 0.595 0.328 7.3e-17
POMBASE|SPAC977.14c 351 SPAC977.14c "aldo/keto reducta 0.292 0.233 0.395 1.3e-14
UNIPROTKB|Q46851346 yghZ [Escherichia coli K-12 (t 0.667 0.540 0.308 4.2e-14
UNIPROTKB|Q8X529346 gpr "L-glyceraldehyde 3-phosph 0.667 0.540 0.308 1.2e-13
TAIR|locus:2009120 AT1G06690 "AT1G06690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1017 (363.1 bits), Expect = 1.3e-102, P = 1.3e-102
 Identities = 193/240 (80%), Positives = 215/240 (89%)

Query:    21 IRAVAS-EGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKA 79
             +RAVAS +  A   + E KVKLGGSDLKVTKLG+G WSWGD SYWN+FQWDDRK+KAAK 
Sbjct:    30 VRAVASGDSVAPAISEESKVKLGGSDLKVTKLGIGVWSWGDNSYWNDFQWDDRKLKAAKG 89

Query:    80 AFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALP 139
             AFDTSLDNGI FFDTAEVYGS+ S GAI+SETLLGRFI+ERK+R P  EV+VATKFAALP
Sbjct:    90 AFDTSLDNGIDFFDTAEVYGSKFSLGAISSETLLGRFIRERKERYPGAEVSVATKFAALP 149

Query:   140 WRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSN 199
             WR GR+SV+ ALKDSL RL LSSV+LYQLHW G+WGNEG++DGLGDAVEQGLVKAVGVSN
Sbjct:   150 WRFGRESVVTALKDSLSRLELSSVDLYQLHWPGLWGNEGYLDGLGDAVEQGLVKAVGVSN 209

Query:   200 YSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGS 259
             YSEKRLR+AYE+LKKRGIPLASNQVNYSLIYR PE+ GVKAACDELG+TLIAY PIAQG+
Sbjct:   210 YSEKRLRDAYERLKKRGIPLASNQVNYSLIYRAPEQTGVKAACDELGVTLIAYSPIAQGA 269
GO:0004033 "aldo-keto reductase (NADP) activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0010287 "plastoglobule" evidence=IDA
TAIR|locus:2168601 PLR1 "AT5G53580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0217 DET_0217 "oxidoreductase, aldo/keto reductase family" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|P77735 yajO [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TAIR|locus:2042124 AT2G27680 "AT2G27680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P63484 MT2355 "Uncharacterized oxidoreductase Rv2298/MT2355" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C2F5 HNE_1371 "Dimethylsulfoxide reductase chain B" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
POMBASE|SPAC977.14c SPAC977.14c "aldo/keto reductase, unknown biological role" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q46851 yghZ [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q8X529 gpr "L-glyceraldehyde 3-phosphate reductase" [Escherichia coli O157:H7 (taxid:83334)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94A68Y1669_ARATH1, ., -, ., -, ., -0.80410.85350.6339yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 6e-60
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 2e-54
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 4e-48
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 8e-41
PRK09912346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 2e-15
PRK10625346 PRK10625, tas, putative aldo-keto reductase; Provi 2e-14
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 3e-11
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 3e-11
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 2e-08
TIGR01293317 TIGR01293, Kv_beta, voltage-dependent potassium ch 2e-08
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 4e-07
PLN02587314 PLN02587, PLN02587, L-galactose dehydrogenase 8e-07
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 8e-05
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information 
 Score =  191 bits (488), Expect = 6e-60
 Identities = 86/226 (38%), Positives = 121/226 (53%), Gaps = 27/226 (11%)

Query: 38  KVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEV 97
              LG + LKV++LG+G W  G         + D +   A AA   +LD GI F DTA+V
Sbjct: 1   YRTLGKTGLKVSRLGLGTWQLGG-------GYVDEE--EAAAAVRAALDAGINFIDTADV 51

Query: 98  YGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPW---RLGRQSVLAALKDS 154
           Y      G   SE LLG  +KER  R+   EV +ATK    P     L  + +  A+++S
Sbjct: 52  Y------GDGESEELLGEALKERGPRE---EVFIATKVGPRPGDGRDLSPEHIRRAVEES 102

Query: 155 LFRLGLSSVELYQLHW--AGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKL 212
           L RLG   ++LY LHW        E  +  L + V++G ++A+GVSN+S ++L  A   L
Sbjct: 103 LKRLGTDYIDLYLLHWPDPDTPDIEETLRALEELVKEGKIRAIGVSNFSAEQLEEA---L 159

Query: 213 KKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQG 258
              G+P A NQV Y+L+ R+ EE  +   C E GI +IAY P+A G
Sbjct: 160 AAAGVPPAVNQVEYNLLDRQAEE-ELLPYCREHGIGVIAYSPLAGG 204

AKRs are present in all phyla and are of importance to both health and industrial applications. Members have very distinct functions and include the prokaryotic 2,5-diketo-D-gluconic acid reductases and beta-keto ester reductases, the eukaryotic aldose reductases, aldehyde reductases, hydroxysteroid dehydrogenases, steroid 5beta-reductases, potassium channel beta-subunits and aflatoxin aldehyde reductases, among others. Length = 285
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 280
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 100.0
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 100.0
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
PRK10625346 tas putative aldo-keto reductase; Provisional 100.0
PLN02587314 L-galactose dehydrogenase 100.0
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
PRK14863292 bifunctional regulator KidO; Provisional 100.0
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 100.0
PRK10376290 putative oxidoreductase; Provisional 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
COG4989298 Predicted oxidoreductase [General function predict 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
KOG1576342 consensus Predicted oxidoreductase [Energy product 100.0
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 100.0
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 98.4
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 92.91
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 92.55
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 92.17
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 91.23
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 90.62
PRK08392215 hypothetical protein; Provisional 90.54
PRK13796 365 GTPase YqeH; Provisional 90.48
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 89.92
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 89.27
PRK08609570 hypothetical protein; Provisional 88.98
PRK13361329 molybdenum cofactor biosynthesis protein A; Provis 87.87
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 87.13
PRK05588255 histidinol-phosphatase; Provisional 86.87
PRK07328269 histidinol-phosphatase; Provisional 86.73
TIGR01928324 menC_lowGC/arch o-succinylbenzoic acid (OSB) synth 86.5
PRK14461371 ribosomal RNA large subunit methyltransferase N; P 85.79
PRK06740331 histidinol-phosphatase; Validated 84.97
KOG0259 447 consensus Tyrosine aminotransferase [Amino acid tr 84.7
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 83.8
COG2089347 SpsE Sialic acid synthase [Cell envelope biogenesi 82.32
TIGR02666334 moaA molybdenum cofactor biosynthesis protein A, b 82.07
PRK07945335 hypothetical protein; Provisional 81.94
PF00682237 HMGL-like: HMGL-like of this family is not conserv 81.68
COG0279176 GmhA Phosphoheptose isomerase [Carbohydrate transp 81.5
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 80.73
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 80.68
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 80.08
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=3.5e-51  Score=372.92  Aligned_cols=210  Identities=38%  Similarity=0.574  Sum_probs=193.0

Q ss_pred             cceeecCCCCccccceeeeccccCCCCCCCCCccchhhHHHHHHHHHHHHHCCCCeEEcccccCCCCCCCCchhhHHHHH
Q 023567           36 EDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGR  115 (280)
Q Consensus        36 m~~r~lg~tg~~vs~lglGt~~~g~~~~~~~~~~~~~~~~~~~~~l~~A~~~Gin~~DTA~~Yg~g~~~~~~~sE~~lG~  115 (280)
                      |++|+||+||++||+||||||.+|+.       ..+.+++++.++|++|+++||||||||+.||.|.+      |+++|+
T Consensus         1 m~~r~lG~~gl~vs~lglG~~~~g~~-------~~~~~~~~a~~il~~A~d~Gin~~DTA~~Yg~g~s------E~ilG~   67 (316)
T COG0667           1 MKYRRLGRSGLKVSPLGLGTMTLGGD-------TDDEEEAEAIEILDAALDAGINFFDTADVYGDGRS------EEILGE   67 (316)
T ss_pred             CCceecCCCCceecceeeeccccCCC-------CCchhhhHHHHHHHHHHHcCCCEEECccccCCCch------HHHHHH
Confidence            78999999999999999999999874       23355678889999999999999999999999988      999999


Q ss_pred             HHHhcccCCCCCcEEEEecCCCCC--------CCCCHHHHHHHHHHHHHHhCCCcccEEEEecCCC-CCchhHHHHHHHH
Q 023567          116 FIKERKQRDPEVEVTVATKFAALP--------WRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGI-WGNEGFIDGLGDA  186 (280)
Q Consensus       116 aL~~~~~~~~R~~~~I~tK~~~~~--------~~~~~~~i~~~l~~sl~~Lg~d~iDl~~lH~pd~-~~~~~~~~~L~~l  186 (280)
                      ||++++.   |++++|+||++...        .+.++++|+++++.||+|||+||||+|++||||. .+.++++.+|.+|
T Consensus        68 ~l~~~~~---Rd~vvIaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l  144 (316)
T COG0667          68 ALKERGR---RDKVVIATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDEL  144 (316)
T ss_pred             HHhccCC---CCeEEEEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHH
Confidence            9999873   79999999998743        3569999999999999999999999999999998 7789999999999


Q ss_pred             HHcCcccEEEecCccHHHHHHHHHHHHhcCCCEEEEcccCCccCCCcchhhHHHHHHHcCCeEEEcccCcCCCCCCCCCC
Q 023567          187 VEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKRNW  266 (280)
Q Consensus       187 k~~G~ir~iGvS~~~~~~i~~~~~~~~~~~~~~~~~q~~~n~~~~~~~~~~l~~~~~~~gi~i~a~spl~~G~L~~~~~~  266 (280)
                      +++|+|++||+|+++.+++.++.+.+    .+++++|.+||+++++.+. +++++|+++||++++||||++|+|++++..
T Consensus       145 ~~~G~ir~iG~S~~~~~~i~~a~~~~----~~~~~~Q~~ynl~~R~~e~-~l~~~~~~~gi~~~~~spla~G~Ltgk~~~  219 (316)
T COG0667         145 VREGKIRYIGVSNYSAEQIAEALAVA----APIDSLQPEYNLLERDAEK-ELLPLCREEGIGLLAYSPLASGLLTGKYLP  219 (316)
T ss_pred             HHcCCeeEEEecCCCHHHHHHHHHhc----CCceeecccCccccccchh-HHHHHHHHcCCeEEEecCccccccCCCcCC
Confidence            99999999999999999999998874    4799999999999986665 499999999999999999999999999987

>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>PRK08392 hypothetical protein; Provisional Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>PRK05588 histidinol-phosphatase; Provisional Back     alignment and domain information
>PRK07328 histidinol-phosphatase; Provisional Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK06740 histidinol-phosphatase; Validated Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial Back     alignment and domain information
>PRK07945 hypothetical protein; Provisional Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>COG0279 GmhA Phosphoheptose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
3uyi_A 337 Crystal Structure Of Perakine Reductase, Founder Me 3e-16
3v0u_A 338 Crystal Structure Of Perakine Reductase, Founder Me 3e-16
3v0t_A 337 Crystal Structure Of Perakine Reductase, Founder Me 3e-16
1pz1_A 333 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 3e-15
3v0s_A 337 Crystal Structure Of Perakine Reductase, Founder Me 3e-15
4aub_A366 The Complex Structure Of The Bacterial Aldo-Keto Re 9e-15
3n6q_A346 Crystal Structure Of Yghz From E. Coli Length = 346 1e-14
1ynp_A317 Aldo-keto Reductase Akr11c1 From Bacillus Haloduran 3e-13
3erp_A353 Structure Of Idp01002, A Putative Oxidoreductase Fr 5e-13
3n2t_A348 Structure Of The Glycerol Dehydrogenase Akr11b4 Fro 1e-11
1pyf_A312 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 1e-11
3eb3_A327 Voltage-Dependent K+ Channel Beta Subunit (W121a) I 2e-10
3eau_A327 Voltage-Dependent K+ Channel Beta Subunit In Comple 2e-10
2a79_A333 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 2e-10
1qrq_A325 Structure Of A Voltage-Dependent K+ Channel Beta Su 2e-10
1exb_A332 Structure Of The Cytoplasmic Beta Subunit-T1 Assemb 2e-10
3lut_A367 A Structural Model For The Full-Length Shaker Potas 3e-10
3eb4_A327 Voltage-Dependent K+ Channel Beta Subunit (I211r) I 3e-10
1zsx_A347 Crystal Structure Of Human Potassium Channel Kv Bet 5e-10
1lqa_A346 Tas Protein From Escherichia Coli In Complex With N 1e-09
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 4e-09
1zua_X317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 2e-08
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 8e-08
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 4e-07
1zgd_A312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 5e-07
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 5e-07
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 1e-06
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 1e-06
3h7u_A335 Crystal Structure Of The Plant Stress-Response Enzy 2e-06
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 6e-06
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 6e-06
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 7e-06
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 7e-06
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 1e-05
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 1e-05
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 3e-05
1m9h_A278 Corynebacterium 2,5-dkgr A And Phe 22 Replaced With 4e-05
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 4e-05
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 4e-05
1a80_A277 Native 2,5-Diketo-D-Gluconic Acid Reductase A From 5e-05
1hw6_A278 Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red 5e-05
2alr_A324 Aldehyde Reductase Length = 324 6e-05
3d3f_A275 Crystal Structure Of Yvgn And Cofactor Nadph From B 6e-05
3f7j_A276 B.Subtilis Yvgn Length = 276 7e-05
3o3r_A316 Crystal Structure Of Akr1b14 In Complex With Nadp L 1e-04
3qkz_A316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 1e-04
3cv6_A323 The Crystal Structure Of Mouse 17-Alpha Hydroxyster 4e-04
2ipg_A319 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 5e-04
3fjn_A323 The Crystal Structure Of 17-Alpha Hydroxysteroid De 5e-04
2he5_A323 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 5e-04
2ipf_A318 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 5e-04
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 7e-04
>pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure 
Iteration: 1

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 114/229 (49%), Gaps = 29/229 (12%)
Query: 38  KVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEV 97
           +VKLG   L+V+KLG G    G +  +N+   +++ +   K AF+     GITFFDT+++
Sbjct: 4   RVKLGTQGLEVSKLGFGCM--GLSGDYNDALPEEQGIAVIKEAFNC----GITFFDTSDI 57
Query: 98  YGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATK-------FAALPWRLGRQSVLAA 150
           YG   S     +E LLG+ +K+     P  ++ V TK       F+ +  +     V + 
Sbjct: 58  YGENGS-----NEELLGKALKQL----PREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSC 108
Query: 151 LKDSLFRLGLSSVELYQLHWAGIWGN-EGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAY 209
            + SL RL +  ++L+ +H        E  +  L   VE+G +K VG+S  S   +R A+
Sbjct: 109 CEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELXKLVEEGKIKYVGLSEASPDTIRRAH 168
Query: 210 EKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQG 258
                   P+ + Q+ YSL  R  E+  +   C +LGI ++ Y PI +G
Sbjct: 169 AVH-----PVTALQIEYSLWTRDIEDE-IVPLCRQLGIGIVPYSPIGRG 211
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 Back     alignment and structure
>pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 Back     alignment and structure
>pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 Back     alignment and structure
>pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 Back     alignment and structure
>pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 Back     alignment and structure
>pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 Back     alignment and structure
>pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 Back     alignment and structure
>pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 Back     alignment and structure
>pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 Back     alignment and structure
>pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 Back     alignment and structure
>pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 Back     alignment and structure
>pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 Back     alignment and structure
>pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 Back     alignment and structure
>pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 Back     alignment and structure
>pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 Back     alignment and structure
>pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 2e-50
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 1e-48
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 1e-46
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 2e-45
3erp_A353 Putative oxidoreductase; funded by the national in 5e-44
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 8e-44
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 7e-41
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 1e-40
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 5e-40
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 6e-40
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 1e-35
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 2e-34
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 3e-27
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 2e-22
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 4e-20
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 2e-19
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-19
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-19
4gie_A290 Prostaglandin F synthase; structural genomics, nia 2e-19
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 4e-19
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 5e-19
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 2e-18
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 4e-18
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 7e-18
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 8e-18
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 2e-17
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 5e-16
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 1e-15
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 2e-15
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 1e-14
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 2e-13
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 3e-13
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 3e-13
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 5e-13
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 1e-12
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 3e-12
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 6e-12
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
 Score =  168 bits (427), Expect = 2e-50
 Identities = 66/240 (27%), Positives = 114/240 (47%), Gaps = 50/240 (20%)

Query: 37  DKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAE 96
           +   +  + ++ +++G+G W+ G T +      D+   K +      +LD GIT  DTA 
Sbjct: 2   EYTSIADTGIEASRIGLGTWAIGGTMWGGT---DE---KTSIETIRAALDQGITLIDTAP 55

Query: 97  VYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWR-------LGRQSVLA 149
            YG    FG   SE ++G+ IKE  +RD   +V +ATK  AL W+         R  ++ 
Sbjct: 56  AYG----FGQ--SEEIVGKAIKEYMKRD---QVILATKT-ALDWKNNQLFRHANRARIVE 105

Query: 150 ALKDSLFRLGLSSVELYQLHWAGIWGNEGFID----------GLGDAVEQGLVKAVGVSN 199
            +++SL RL    ++LYQ+HW          D           + +  + G ++A+GVSN
Sbjct: 106 EVENSLKRLQTDYIDLYQVHW---------PDPLVPIEETAEVMKELYDAGKIRAIGVSN 156

Query: 200 YSEKRLRNAYEKLKKRGI-PLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQG 258
           +S +++         R + PL + Q  Y+L  R+ EE+ V     +  IT + Y  + +G
Sbjct: 157 FSIEQMDTF------RAVAPLHTIQPPYNLFEREMEES-VLPYAKDNKITTLLYGSLCRG 209
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 100.0
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 100.0
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 100.0
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.9
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 93.97
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 93.76
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 93.66
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 93.33
2o56_A407 Putative mandelate racemase; dehydratase, structur 92.98
2qgy_A391 Enolase from the environmental genome shotgun sequ 92.85
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 92.59
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 92.39
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 92.39
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 92.2
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 92.09
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 91.99
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 91.9
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 91.78
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 91.57
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 91.55
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 91.53
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 91.53
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 91.51
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 91.37
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 91.34
2gl5_A410 Putative dehydratase protein; structural genomics, 91.27
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 90.89
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 90.81
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 90.63
2poz_A392 Putative dehydratase; octamer, structural genomics 90.63
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 90.55
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 90.24
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 90.14
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 89.7
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 89.27
1tzz_A392 Hypothetical protein L1841; structural genomics, m 88.99
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 88.77
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 88.58
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 88.3
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 88.1
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 87.97
3r0u_A379 Enzyme of enolase superfamily; structural genomics 87.78
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 87.5
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 87.47
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 87.17
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 87.14
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 87.12
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 87.06
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 87.02
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 86.13
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 86.0
2oz8_A389 MLL7089 protein; structural genomics, unknown func 85.94
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 85.79
3eez_A378 Putative mandelate racemase/muconate lactonizing e 85.75
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 85.61
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 85.46
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 85.04
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 84.41
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 84.32
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 84.19
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 83.63
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 82.97
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; 82.6
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 82.07
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 81.88
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 81.27
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 80.91
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 80.79
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 80.5
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 80.37
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
Probab=100.00  E-value=7.3e-52  Score=378.47  Aligned_cols=215  Identities=27%  Similarity=0.402  Sum_probs=193.2

Q ss_pred             ccceeecCCCCccccceeeecc-ccCCCCCCCCCccchhhHHHHHHHHHHHHHCCCCeEEcccccCCCCCCCCchhhHHH
Q 023567           35 AEDKVKLGGSDLKVTKLGVGAW-SWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLL  113 (280)
Q Consensus        35 ~m~~r~lg~tg~~vs~lglGt~-~~g~~~~~~~~~~~~~~~~~~~~~l~~A~~~Gin~~DTA~~Yg~g~~~~~~~sE~~l  113 (280)
                      .|+||+||+||++||+|||||| .+|+.          .+++++.++|+.|+++|||+||||+.||+|.+      |+.+
T Consensus         2 ~m~yr~lG~tg~~vs~iglGt~~~~g~~----------~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~G~s------E~~l   65 (327)
T 3eau_A            2 LQFYRNLGKSGLRVSCLGLGTWVTFGGQ----------ITDEMAEHLMTLAYDNGINLFDTAEVYAAGKA------EVVL   65 (327)
T ss_dssp             CCSEEESTTSSCEEESEEEECTTCCCCC----------SCHHHHHHHHHHHHHTTCCEEEEETTGGGGHH------HHHH
T ss_pred             cchhcccCCCCCcccceeecCccccCCC----------CCHHHHHHHHHHHHHcCCCEEECccccCCCCh------HHHH
Confidence            3899999999999999999998 44432          46689999999999999999999999999988      9999


Q ss_pred             HHHHHhcccCCCCCcEEEEecCCCC-----CCCCCHHHHHHHHHHHHHHhCCCcccEEEEecCCC-CCchhHHHHHHHHH
Q 023567          114 GRFIKERKQRDPEVEVTVATKFAAL-----PWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGI-WGNEGFIDGLGDAV  187 (280)
Q Consensus       114 G~aL~~~~~~~~R~~~~I~tK~~~~-----~~~~~~~~i~~~l~~sl~~Lg~d~iDl~~lH~pd~-~~~~~~~~~L~~lk  187 (280)
                      |++|++.+.  +|+++||+||++..     ..+++++.+++++++||++||+||||+|++|||+. .+.+++|++|++|+
T Consensus        66 G~al~~~~~--~R~~v~I~TK~~~~~~~~~~~~~s~~~i~~~~e~SL~rLg~dyiDl~~lH~p~~~~~~~e~~~al~~l~  143 (327)
T 3eau_A           66 GNIIKKKGW--RRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVI  143 (327)
T ss_dssp             HHHHHHHTC--CGGGCEEEEEESBCCSSGGGBSSSHHHHHHHHHHHHHHHTCSCEEEEEESSCCTTSCHHHHHHHHHHHH
T ss_pred             HHHHHhcCC--ccCeEEEEEeecCCCCCCCCCCCCHHHHHHHHHHHHHHhCCCccceEEEeCCCCCCCHHHHHHHHHHHH
Confidence            999998754  38999999998531     12468999999999999999999999999999997 67889999999999


Q ss_pred             HcCcccEEEecCccHHHHHHHHHHHHhcC-CCEEEEcccCCccCCCcchhhHHHHHHHcCCeEEEcccCcCCCCCCCCCC
Q 023567          188 EQGLVKAVGVSNYSEKRLRNAYEKLKKRG-IPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKRNW  266 (280)
Q Consensus       188 ~~G~ir~iGvS~~~~~~i~~~~~~~~~~~-~~~~~~q~~~n~~~~~~~~~~l~~~~~~~gi~i~a~spl~~G~L~~~~~~  266 (280)
                      ++||||+||||||++++++++.+.+...+ ++|+++|++||++++...+.+++++|+++||++++|+||++|+|++++..
T Consensus       144 ~~Gkir~iGvSn~~~~~l~~~~~~~~~~~~~~~~~~Q~~~~~~~~~~~~~~l~~~~~~~gi~v~a~spL~~G~Ltg~~~~  223 (327)
T 3eau_A          144 NQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDS  223 (327)
T ss_dssp             HTTSEEEEEEESCCHHHHHHHHHHHHHTTCCCCCEEEEECBTTBCHHHHHHHHHHHHHHCCEEEEECTTGGGGGGTTTTT
T ss_pred             HcCCeeEEeecCCCHHHHHHHHHHHHHcCCCCceeecccccccccchhHhhHHHHHHHcCCeEEEeccccCceecCcccC
Confidence            99999999999999999999999887666 58999999999998876555799999999999999999999999999875


Q ss_pred             C
Q 023567          267 W  267 (280)
Q Consensus       267 ~  267 (280)
                      .
T Consensus       224 ~  224 (327)
T 3eau_A          224 G  224 (327)
T ss_dssp             S
T ss_pred             C
Confidence            3
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 280
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 6e-33
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 6e-26
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 8e-24
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 5e-21
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 1e-18
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 1e-17
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-17
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 6e-17
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-15
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 3e-15
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 4e-15
d1gvea_ 324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 2e-14
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 3e-14
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 5e-14
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 1e-13
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 3e-12
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Tas protein
species: Escherichia coli [TaxId: 562]

 Score =  121 bits (303), Expect = 6e-33
 Identities = 57/248 (22%), Positives = 98/248 (39%), Gaps = 38/248 (15%)

Query: 38  KVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEV 97
             ++  S L+V+ LG+G  ++G+       Q  +     A A  D ++  GI   D AE+
Sbjct: 3   YHRIPHSSLEVSTLGLGTMTFGE-------QNSE---ADAHAQLDYAVAQGINLIDVAEM 52

Query: 98  YGS-RASFGAINSETLLGRFIKERKQRDPEVEVTVA-------TKFAALPWRLGRQSVLA 149
           Y           +ET +G ++ +   R+  +  +          K       L R+++  
Sbjct: 53  YPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIRE 112

Query: 150 ALKDSLFRLGLSSVELYQLHWAG------------------IWGNEGFIDGLGDAVEQGL 191
           AL DSL RL    ++LYQ+HW                           +D L +    G 
Sbjct: 113 ALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGK 172

Query: 192 VKAVGVSNYSEKRLRNAYEKLKKRGIP-LASNQVNYSLIYRKPEENGVKAACDELGITLI 250
           ++ +GVSN +   +        K  +P + + Q  YSL+ R  E  G+       G+ L+
Sbjct: 173 IRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEV-GLAEVSQYEGVELL 231

Query: 251 AYCPIAQG 258
           AY  +  G
Sbjct: 232 AYSCLGFG 239
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1pz1a_ 333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d1gvea_ 324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 100.0
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 92.88
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 92.27
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 91.98
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 91.89
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 91.67
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 91.43
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 90.37
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 89.71
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 86.5
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 84.65
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 81.02
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 80.93
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 80.8
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=4.2e-47  Score=341.62  Aligned_cols=214  Identities=27%  Similarity=0.404  Sum_probs=192.6

Q ss_pred             ceeecCCCCccccceeeeccccCCCCCCCCCccchhhHHHHHHHHHHHHHCCCCeEEcccccCCCCCCCCchhhHHHHHH
Q 023567           37 DKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRF  116 (280)
Q Consensus        37 ~~r~lg~tg~~vs~lglGt~~~g~~~~~~~~~~~~~~~~~~~~~l~~A~~~Gin~~DTA~~Yg~g~~~~~~~sE~~lG~a  116 (280)
                      ++|+||+||++||+||||||++|....|     ...+++++.++|+.|+++|||+||||+.||+|.+      |+.+|++
T Consensus         1 ~~~rLG~tgl~vS~iglGt~~~g~~~~~-----~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~g~s------E~~lg~~   69 (311)
T d1pyfa_           1 KKAKLGKSDLQVFPIGLGTNAVGGHNLY-----PNLNEETGKELVREAIRNGVTMLDTAYIYGIGRS------EELIGEV   69 (311)
T ss_dssp             CCEECTTSCCEECSBCEECTTSSCTTTC-----SSCCHHHHHHHHHHHHHTTCCEEECCTTTTTTHH------HHHHHHH
T ss_pred             CCcccCCCCCeecceeeeCcccCCCCCC-----CCCCHHHHHHHHHHHHHcCCCEEEehhhcCCCcc------HHHHhhh
Confidence            5899999999999999999999875333     3467789999999999999999999999999988      9999999


Q ss_pred             HHhcccCCCCCcEEEEecCCCC------CCCCCHHHHHHHHHHHHHHhCCCcccEEEEecCCC-CCchhHHHHHHHHHHc
Q 023567          117 IKERKQRDPEVEVTVATKFAAL------PWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGI-WGNEGFIDGLGDAVEQ  189 (280)
Q Consensus       117 L~~~~~~~~R~~~~I~tK~~~~------~~~~~~~~i~~~l~~sl~~Lg~d~iDl~~lH~pd~-~~~~~~~~~L~~lk~~  189 (280)
                      |+..+    |++++|+||++..      ..+.+++.+++++++||++|++||||++++|+|+. .+.++++++|++|+++
T Consensus        70 l~~~~----r~~~~i~tK~~~~~~~~~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~  145 (311)
T d1pyfa_          70 LREFN----REDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKA  145 (311)
T ss_dssp             HTTSC----GGGCEEEEEECEEEETTEEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHT
T ss_pred             hhccc----ccceecceeccCCCCCcccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhC
Confidence            98764    8999999999752      24688999999999999999999999999999988 6788999999999999


Q ss_pred             CcccEEEecCccHHHHHHHHHHHHhcCCCEEEEcccCCccCCCcchhhHHHHHHHcCCeEEEcccCcCCCCCCCCCCCCC
Q 023567          190 GLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGSKPRKRNWWFH  269 (280)
Q Consensus       190 G~ir~iGvS~~~~~~i~~~~~~~~~~~~~~~~~q~~~n~~~~~~~~~~l~~~~~~~gi~i~a~spl~~G~L~~~~~~~~~  269 (280)
                      |+|++||+|+++.+.+.++.+.     .+++++|++||++++.... +++++|+++||++++|+||++|+|++++.....
T Consensus       146 Gkir~iGvs~~~~~~~~~~~~~-----~~~~~~q~~~n~~~~~~~~-~~~~~~~~~~i~v~~~~~l~~G~l~~~~~~~~~  219 (311)
T d1pyfa_         146 GKIRSIGVSNFSLEQLKEANKD-----GLVDVLQGEYNLLNREAEK-TFFPYTKEHNISFIPYFPLVSGLLAGKYTEDTT  219 (311)
T ss_dssp             TSBSCEEEESCCHHHHHHHTTT-----SCCCEEEEECBTTBCGGGT-THHHHHHHHTCEEEEESTTTTTGGGTCCCTTCC
T ss_pred             CeEEeecccCCcHHHHHHHhhc-----CCcceEeeeecccchhhhH-HHHHHHHHCCceEEEeccccCCccCCCcCcCCC
Confidence            9999999999999999988654     5799999999999988765 699999999999999999999999999876544


Q ss_pred             cc
Q 023567          270 CL  271 (280)
Q Consensus       270 ~~  271 (280)
                      .+
T Consensus       220 ~~  221 (311)
T d1pyfa_         220 FP  221 (311)
T ss_dssp             CC
T ss_pred             Cc
Confidence            44
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure