BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023582
         (280 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3FVY|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iii
          Length = 728

 Score = 27.7 bits (60), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 58 AWAIAQLGWVAGPAVLMAFSFITYYTSTLLSDCYRSPDP 96
          A+ +++  W  G AVL+  S    Y   LLS  +R+ DP
Sbjct: 36 AYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDP 74


>pdb|3T6B|A Chain A, Structure Of Human Dppiii In Complex With The Opioid
          Peptide Tynorphin, At 2.4 Angstroms
 pdb|3T6B|B Chain B, Structure Of Human Dppiii In Complex With The Opioid
          Peptide Tynorphin, At 2.4 Angstroms
 pdb|3T6J|A Chain A, Structure Of Human Dppiii In Complex With The Opioid
          Peptide Tynorphin, At 3.0 Angstroms
          Length = 726

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 58 AWAIAQLGWVAGPAVLMAFSFITYYTSTLLSDCYRSPDP 96
          A+ +++  W  G AVL+  S    Y   LLS  +R+ DP
Sbjct: 34 AYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDP 72


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.134    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,411,520
Number of Sequences: 62578
Number of extensions: 272736
Number of successful extensions: 593
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 587
Number of HSP's gapped (non-prelim): 10
length of query: 280
length of database: 14,973,337
effective HSP length: 98
effective length of query: 182
effective length of database: 8,840,693
effective search space: 1609006126
effective search space used: 1609006126
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 51 (24.3 bits)