BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023594
(280 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q6AE15|HIS4_LEIXX 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
imidazole-4-carboxamide isomerase OS=Leifsonia xyli
subsp. xyli (strain CTCB07) GN=hisA PE=3 SV=1
Length = 248
Score = 32.3 bits (72), Expect = 4.0, Method: Compositional matrix adjust.
Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 3/64 (4%)
Query: 130 QIFVMSQNISDALKENLAWATYVLLRNTNSISVLISIRG-ELCVRGYWQTPDGASKTQLL 188
+I N+ A EN WA++V+ + +I+V + +RG L RG+ T +G Q+L
Sbjct: 102 EIGATRVNLGTAALENPEWASHVIGQYGEAIAVGLDVRGTTLAARGW--TREGGDLWQVL 159
Query: 189 EWFE 192
E E
Sbjct: 160 ERLE 163
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.319 0.133 0.393
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 99,553,134
Number of Sequences: 539616
Number of extensions: 3890909
Number of successful extensions: 8414
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 8414
Number of HSP's gapped (non-prelim): 2
length of query: 280
length of database: 191,569,459
effective HSP length: 116
effective length of query: 164
effective length of database: 128,974,003
effective search space: 21151736492
effective search space used: 21151736492
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)