BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023594
         (280 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q6AE15|HIS4_LEIXX 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
           imidazole-4-carboxamide isomerase OS=Leifsonia xyli
           subsp. xyli (strain CTCB07) GN=hisA PE=3 SV=1
          Length = 248

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 130 QIFVMSQNISDALKENLAWATYVLLRNTNSISVLISIRG-ELCVRGYWQTPDGASKTQLL 188
           +I     N+  A  EN  WA++V+ +   +I+V + +RG  L  RG+  T +G    Q+L
Sbjct: 102 EIGATRVNLGTAALENPEWASHVIGQYGEAIAVGLDVRGTTLAARGW--TREGGDLWQVL 159

Query: 189 EWFE 192
           E  E
Sbjct: 160 ERLE 163


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.319    0.133    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 99,553,134
Number of Sequences: 539616
Number of extensions: 3890909
Number of successful extensions: 8414
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 8414
Number of HSP's gapped (non-prelim): 2
length of query: 280
length of database: 191,569,459
effective HSP length: 116
effective length of query: 164
effective length of database: 128,974,003
effective search space: 21151736492
effective search space used: 21151736492
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)