BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023600
         (280 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CE2|A Chain A, Crystal Structure Of Putative Peptidase From Chlamydophila
           Abortus
          Length = 618

 Score = 27.7 bits (60), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 14/66 (21%)

Query: 159 QYLYEIYNHDVEMRVSKAGVNLL---LSKWMKELEKIFYGNIVAFDAALLPEAKQDELQN 215
           Q L+  + +D+    ++ GV L    LS   K L+  FYG I+ FD           L N
Sbjct: 472 QVLFASFEYDIH-HAAEHGVPLTEEYLSSTYKNLQNEFYGEIITFDV----------LSN 520

Query: 216 VIWRNI 221
           + W  I
Sbjct: 521 IEWARI 526


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.136    0.408 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,460,556
Number of Sequences: 62578
Number of extensions: 206893
Number of successful extensions: 468
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 468
Number of HSP's gapped (non-prelim): 1
length of query: 280
length of database: 14,973,337
effective HSP length: 98
effective length of query: 182
effective length of database: 8,840,693
effective search space: 1609006126
effective search space used: 1609006126
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)