Citrus Sinensis ID: 023614


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MSDVPPPQPPKPRILIREVFEFNLISEFERIRALIDRYPIISMDTEFPGVVVRPDSNIRHRDPAANYNGLKANVDLLNLIQIGLTLSDEEGNLPDLGSGSTYYIWEFNFKDFDIARHAHALDSVELLKRQGIDFEKNREFGIDSVRFAELLMSSGLVLNKDVTWVTFHSAYDFGYLVKCLTQRVLPEKLSEFVTRVGVFFGEKVYDVKHLIRFCTCLYGGLDRVCKALGVERVVGKSHQAGSDSLLTLHAFLKIKDKHFGNEYELQKYANVLHGLELLEC
ccccccccccccccEEEEcccccHHHHHHHHHHHHHccccEEEccccccccccccccccccccHHHHHHHHHHcccccEEEEEEEEccccccccccccccccEEEEEcccccccccccccHHHHHHHHHccccHHHHHHccccHHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHccccccccHHHHHHHHcHHccccEEEHHHHHHHHcccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccccccccccEEEccccccc
**********KPRILIREVFEFNLISEFERIRALIDRYPIISMDTEFPGVVVRPDSNIRHRDPAANYNGLKANVDLLNLIQIGLTLSDEEGNLPDLGSGSTYYIWEFNFKDFDIARHAHALDSVELLKRQGIDFEKNREFGIDSVRFAELLMSSGLVLNKDVTWVTFHSAYDFGYLVKCLTQRVLPEKLSEFVTRVGVFFGEKVYDVKHLIRFCTCLYGGLDRVCKALGVERVVGKSHQAGSDSLLTLHAFLKIKDKHFGNEYELQKYANVLHGLELLEC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDVPPPQPPKPRILIREVFEFNLISEFERIRALIDRYPIISMDTEFPGVVVRPDSNIRHRDPAANYNGLKANVDLLNLIQIGLTLSDEEGNLPDLGSGSTYYIWEFNFKDFDIARHAHALDSVELLKRQGIDFEKNREFGIDSVRFAELLMSSGLVLNKDVTWVTFHSAYDFGYLVKCLTQRVLPEKLSEFVTRVGVFFGEKVYDVKHLIRFCTCLYGGLDRVCKALGVERVVGKSHQAGSDSLLTLHAFLKIKDKHFGNEYELQKYANVLHGLELLEC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable CCR4-associated factor 1 homolog 11 Ubiquitous transcription factor required for a diverse set of processes. It is a component of the CCR4 complex involved in the control of gene expression.probableQ9FMS6
CCR4-NOT transcription complex subunit 8 Ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex.probableQ9D8X5
CCR4-NOT transcription complex subunit 8 Ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex.probableQ9UFF9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P51, chain A
Confidence level:very confident
Coverage over the Query: 11-275
View the alignment between query and template
View the model in PyMOL