Citrus Sinensis ID: 023631

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MSVSLNANLYQPSLSCNLKLFSGLKIQSPSVFGTGKPNLSAEFYGRVHKSLYSGIRNDKPIRGRIAMMPIGTPKVLYRTPGEGSWQWVDLWNALYRERVIFIGQNIDEEFSNQILATMLYLDSVDDSKRVYMYINGPGGDVTPTLAIYDTMQSLKSPVGTHCVGFAYHLAGFLLAGGEKGNRSAMPLSRIALDSPAGAARGQADDIRNEADELLRVRDYIFKELSRKTGQPFEKITKDLSRIKRFGSQEALEYGLIDRIIRPPRIKEDMPRKDAGTGLG
ccccccccccccccccccHHcccccccccccccccccccccHHHHccccccccccccccccccccccccccccEEEECccccccccHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHccccccccEEEEEccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccEEECcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHccccCEECccccccccccccccccccc
********LYQPSLSCNLKLFSGLKIQSPSVFGTGKPNLSAEFYGRVHKSLYS***N**PIRGRIAMMPIGTPKVLYRTPGEGSWQWVDLWNALYRERVIFIGQNIDEEFSNQILATMLYLDSVDDSKRVYMYINGPGGDVTPTLAIYDTMQSLKSPVGTHCVGFAYHLAGFLLAGGEKGNRSAMPLSRIALDSPAGAARGQADDIRNEADELLRVRDYIFKELSRKTGQPFEKITKDLSRIKRFGSQEALEYGLIDRIIR******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVSLNANLYQPSLSCNLKLFSGLKIQSPSVFGTGKPNLSAEFYGRVHKSLYSGIRNDKPIRGRIAMMPIGTPKVLYRTPGEGSWQWVDLWNALYRERVIFIGQNIDEEFSNQILATMLYLDSVDDSKRVYMYINGPGGDVTPTLAIYDTMQSLKSPVGTHCVGFAYHLAGFLLAGGEKGNRSAMPLSRIALDSPAGAARGQADDIRNEADELLRVRDYIFKELSRKTGQPFEKITKDLSRIKRFGSQEALEYGLIDRIIRPPRIKEDMPRKDAGTGLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic Required for chloroplast development and integrity. Involved in the regulation of plastoglobules formation.confidentQ9XJ36
ATP-dependent Clp protease proteolytic subunit 2 Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableQ8DJZ9
ATP-dependent Clp protease proteolytic subunit 3 Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableQ3AVC3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.21.-Serine endopeptidases.probable
3.4.21.92Endopeptidase Clp.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Y7O, chain A
Confidence level:very confident
Coverage over the Query: 72-195,209-263
View the alignment between query and template
View the model in PyMOL