Citrus Sinensis ID: 023704


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MNIYGNSLHTTLHNHSQFTMSGRRVLREPPLSTRALPPQHSPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQEMIKDLNEINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIMEKNIISVAQQIERLQAELANAEKRARAAAAAAAVNPSTSYAASYGNPDPGFGGSLYADPYSMHQVQGSAEHGHQ
cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc
*******************************************************************LAATHVAL******************************ELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQEMIKDLNEIN*****************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIYGNSLHTTLHNHSQFTMSGRRVLREPPLSTRALPPQHSPSLHHLEDRIAIQHSDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIHKGRAAIECEKKNRASNHEQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAAVNPSTSYAASYGNPDPGFGGSLYADPYSMHQVQGSAEHGHQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 87-187
View the alignment between query and template
View the model in PyMOL
Template: 4GKW, chain A
Confidence level:probable
Coverage over the Query: 118-200,215-228
View the alignment between query and template
View the model in PyMOL
Template: 3HNW, chain A
Confidence level:probable
Coverage over the Query: 16-82
View the alignment between query and template
View the model in PyMOL
Template: 1GXL, chain A
Confidence level:probable
Coverage over the Query: 2-56
View the alignment between query and template
View the model in PyMOL