BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023709
         (278 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1G1A|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb)from Salmonella Enterica Serovar Typhimurium
 pdb|1G1A|B Chain B, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb)from Salmonella Enterica Serovar Typhimurium
 pdb|1G1A|C Chain C, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb)from Salmonella Enterica Serovar Typhimurium
 pdb|1G1A|D Chain D, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb)from Salmonella Enterica Serovar Typhimurium
 pdb|1KEU|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb) From Salmonella Enterica Serovar Typhimurium With
           Dtdp-D-Glucose Bound
 pdb|1KEU|B Chain B, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb) From Salmonella Enterica Serovar Typhimurium With
           Dtdp-D-Glucose Bound
 pdb|1KEW|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb) From Salmonella Enterica Serovar Typhimurium With
           Thymidine Diphosphate Bound
 pdb|1KEW|B Chain B, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb) From Salmonella Enterica Serovar Typhimurium With
           Thymidine Diphosphate Bound
          Length = 361

 Score = 28.1 bits (61), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 232 FEDMSCEMVYGQVPPSFEDDPVSTQPCFTDICSNANPSSP 271
           F  +S + VYG +P   E +   T P FT+  + A PSSP
Sbjct: 128 FHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYA-PSSP 166


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.136    0.428 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,073,162
Number of Sequences: 62578
Number of extensions: 312434
Number of successful extensions: 669
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 669
Number of HSP's gapped (non-prelim): 1
length of query: 278
length of database: 14,973,337
effective HSP length: 98
effective length of query: 180
effective length of database: 8,840,693
effective search space: 1591324740
effective search space used: 1591324740
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)