BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023719
         (278 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1XHL|A Chain A, Crystal Structure Of Putative Tropinone Reductase-Ii From
           Caenorhabditis Elegans With Cofactor And Substrate
 pdb|1XHL|B Chain B, Crystal Structure Of Putative Tropinone Reductase-Ii From
           Caenorhabditis Elegans With Cofactor And Substrate
          Length = 297

 Score = 27.3 bits (59), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 20  VELIVCNSSPSAADGGGTASDEISPLLAQSEKPKTNIFSVSYTRRKPREHVIETDTSLTN 79
           ++++V N+  + ADG  TA+ +  P+    +  K N  +V    +K +EH+I+T   + N
Sbjct: 107 IDILVNNAGANLADG--TANTD-QPVELYQKTFKLNFQAVIEMTQKTKEHLIKTKGEIVN 163

Query: 80  CMLWVWNGSRYSG 92
               V     +SG
Sbjct: 164 VSSIVAGPQAHSG 176


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.138    0.408 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,802,607
Number of Sequences: 62578
Number of extensions: 240618
Number of successful extensions: 492
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 492
Number of HSP's gapped (non-prelim): 1
length of query: 278
length of database: 14,973,337
effective HSP length: 98
effective length of query: 180
effective length of database: 8,840,693
effective search space: 1591324740
effective search space used: 1591324740
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)