Citrus Sinensis ID: 023731


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MDSKTVVDMIEASSGVHFSGFHMDGLEVRNKETGQPTISAAENLHRQPFVIGVAGGAASGKTTVCDMIIQQLHDQRVVLVNQDSFYHNLTEQELARVHEYNFDHPDAFDTEKLLSSMEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQVSFSYSLTT
cccHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHccccEEEcccccccccccccccEEEccccEEEEEcccccccHHHHHHcccEEEEEcccHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHcccccccccEEEccccccHHHHHHHHHHHHHHHcccccccccccEEEEcccccEEEEEcccc
***************VHFSGFHMD******************NLHRQPFVIGVAGGAASGKTTVCDMIIQQLHDQRVVLVNQDSFYHNLTEQELARVHEYNFDHPDAFDTEKLLSSMEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQVSFSYSL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSKTVVDMIEASSGVHFSGFHMDGLEVRNKETGQPTISAAENLHRQPFVIGVAGGAASGKTTVCDMIIQQLHDQRVVLVNQDSFYHNLTEQELARVHEYNFDHPDAFDTEKLLSSMEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQVSFSYSLTT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uridine-cytidine kinase 2 Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine.probableQ9BZX2
Uridine-cytidine kinase 2 Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine.probableQ9QYG8
Uridine kinase-like protein 3 Involved in the pyrimidine salvage pathway. The uracil phosphoribosyltransferase (UPRT) activity, that catalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate, is unsure.probableQ8VYB2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable
2.7.1.48Uridine kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JEO, chain A
Confidence level:very confident
Coverage over the Query: 46-252
View the alignment between query and template
View the model in PyMOL
Template: 1IN4, chain A
Confidence level:probable
Coverage over the Query: 8-85
View the alignment between query and template
View the model in PyMOL