BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023732
(278 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1N7G|A Chain A, Crystal Structure Of The Gdp-mannose 4,6-dehydratase
Ternary Complex With Nadph And Gdp-rhamnose.
pdb|1N7G|B Chain B, Crystal Structure Of The Gdp-mannose 4,6-dehydratase
Ternary Complex With Nadph And Gdp-rhamnose.
pdb|1N7G|C Chain C, Crystal Structure Of The Gdp-mannose 4,6-dehydratase
Ternary Complex With Nadph And Gdp-rhamnose.
pdb|1N7G|D Chain D, Crystal Structure Of The Gdp-mannose 4,6-dehydratase
Ternary Complex With Nadph And Gdp-rhamnose.
pdb|1N7H|A Chain A, Crystal Structure Of Gdp-Mannose 4,6-Dehydratase Ternary
Complex With Nadph And Gdp
pdb|1N7H|B Chain B, Crystal Structure Of Gdp-Mannose 4,6-Dehydratase Ternary
Complex With Nadph And Gdp
Length = 381
Score = 27.7 bits (60), Expect = 8.2, Method: Compositional matrix adjust.
Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 6/86 (6%)
Query: 184 VIRMLNNA-TRVAVGMSDRAYQFDMKALNRWGYYPLILIGSWAFGTINRIHDFI---EPG 239
V R + A R+ VG+ + + +++A WG+ + W + D++ E G
Sbjct: 225 VTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEG 284
Query: 240 HKIFWLTFLDVGTAALMVNCNDHIFV 265
H + FLDV L +N D++ +
Sbjct: 285 HTV--EEFLDVSFGYLGLNWKDYVEI 308
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.332 0.142 0.473
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,994,073
Number of Sequences: 62578
Number of extensions: 309110
Number of successful extensions: 580
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 580
Number of HSP's gapped (non-prelim): 3
length of query: 278
length of database: 14,973,337
effective HSP length: 98
effective length of query: 180
effective length of database: 8,840,693
effective search space: 1591324740
effective search space used: 1591324740
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 51 (24.3 bits)