BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023732
         (278 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1N7G|A Chain A, Crystal Structure Of The Gdp-mannose 4,6-dehydratase
           Ternary Complex With Nadph And Gdp-rhamnose.
 pdb|1N7G|B Chain B, Crystal Structure Of The Gdp-mannose 4,6-dehydratase
           Ternary Complex With Nadph And Gdp-rhamnose.
 pdb|1N7G|C Chain C, Crystal Structure Of The Gdp-mannose 4,6-dehydratase
           Ternary Complex With Nadph And Gdp-rhamnose.
 pdb|1N7G|D Chain D, Crystal Structure Of The Gdp-mannose 4,6-dehydratase
           Ternary Complex With Nadph And Gdp-rhamnose.
 pdb|1N7H|A Chain A, Crystal Structure Of Gdp-Mannose 4,6-Dehydratase Ternary
           Complex With Nadph And Gdp
 pdb|1N7H|B Chain B, Crystal Structure Of Gdp-Mannose 4,6-Dehydratase Ternary
           Complex With Nadph And Gdp
          Length = 381

 Score = 27.7 bits (60), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 6/86 (6%)

Query: 184 VIRMLNNA-TRVAVGMSDRAYQFDMKALNRWGYYPLILIGSWAFGTINRIHDFI---EPG 239
           V R +  A  R+ VG+  + +  +++A   WG+    +   W      +  D++   E G
Sbjct: 225 VTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEG 284

Query: 240 HKIFWLTFLDVGTAALMVNCNDHIFV 265
           H +    FLDV    L +N  D++ +
Sbjct: 285 HTV--EEFLDVSFGYLGLNWKDYVEI 308


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.332    0.142    0.473 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,994,073
Number of Sequences: 62578
Number of extensions: 309110
Number of successful extensions: 580
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 580
Number of HSP's gapped (non-prelim): 3
length of query: 278
length of database: 14,973,337
effective HSP length: 98
effective length of query: 180
effective length of database: 8,840,693
effective search space: 1591324740
effective search space used: 1591324740
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 51 (24.3 bits)