BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023784
         (277 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3I2T|A Chain A, Crystal Structure Of The Unliganded Drosophila Epidermal
           Growth Factor Receptor Ectodomain
          Length = 551

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 1   MSGSQWNEVALNGEDLSYMLDDETTPVKACGDLAYHATHNGNMSKEPKDCRE 52
           M   QW+E+  NG D +Y   D T P + C       TH G   + PK+C++
Sbjct: 137 MRTIQWSEIVSNGTD-AYYNYDFTAPERECPKCHESCTH-GCWGEGPKNCQK 186


>pdb|3LTF|A Chain A, Crystal Structure Of The Drosophila Epidermal Growth
           Factor Receptor Ectodomain In Complex With Spitz
 pdb|3LTF|C Chain C, Crystal Structure Of The Drosophila Epidermal Growth
           Factor Receptor Ectodomain In Complex With Spitz
 pdb|3LTG|A Chain A, Crystal Structure Of The Drosophila Epidermal Growth
           Factor Receptor Ectodomain Complexed With A Low Affinity
           Spitz Mutant
 pdb|3LTG|C Chain C, Crystal Structure Of The Drosophila Epidermal Growth
           Factor Receptor Ectodomain Complexed With A Low Affinity
           Spitz Mutant
          Length = 601

 Score = 29.6 bits (65), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 1   MSGSQWNEVALNGEDLSYMLDDETTPVKACGDLAYHATHNGNMSKEPKDCRE 52
           M   QW+E+  NG D  Y   D T P + C       TH G   + PK+C++
Sbjct: 137 MRTIQWSEIVSNGTDAYYNY-DFTAPERECPKCHESCTH-GCWGEGPKNCQK 186


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.313    0.129    0.380 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,601,133
Number of Sequences: 62578
Number of extensions: 341090
Number of successful extensions: 557
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 557
Number of HSP's gapped (non-prelim): 3
length of query: 277
length of database: 14,973,337
effective HSP length: 98
effective length of query: 179
effective length of database: 8,840,693
effective search space: 1582484047
effective search space used: 1582484047
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 51 (24.3 bits)