BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023791
(277 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q32PY9|GNTK_RAT Probable gluconokinase OS=Rattus norvegicus GN=Idnk PE=2 SV=1
Length = 185
Score = 31.2 bits (69), Expect = 7.7, Method: Compositional matrix adjust.
Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 4/46 (8%)
Query: 75 RVPSKKWLCRSHDPISPDNEYRSSRNIAISLFRR-YRNVIDRGGGD 119
R+P WLC HD + D S +A S ++ YR++++RGG D
Sbjct: 58 RIP---WLCSLHDILLRDVASGQSVVLACSALKKMYRDILNRGGSD 100
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.321 0.136 0.433
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 107,340,099
Number of Sequences: 539616
Number of extensions: 4397109
Number of successful extensions: 7539
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 7538
Number of HSP's gapped (non-prelim): 2
length of query: 277
length of database: 191,569,459
effective HSP length: 116
effective length of query: 161
effective length of database: 128,974,003
effective search space: 20764814483
effective search space used: 20764814483
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)