BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023791
         (277 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q32PY9|GNTK_RAT Probable gluconokinase OS=Rattus norvegicus GN=Idnk PE=2 SV=1
          Length = 185

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 75  RVPSKKWLCRSHDPISPDNEYRSSRNIAISLFRR-YRNVIDRGGGD 119
           R+P   WLC  HD +  D     S  +A S  ++ YR++++RGG D
Sbjct: 58  RIP---WLCSLHDILLRDVASGQSVVLACSALKKMYRDILNRGGSD 100


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.321    0.136    0.433 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 107,340,099
Number of Sequences: 539616
Number of extensions: 4397109
Number of successful extensions: 7539
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 7538
Number of HSP's gapped (non-prelim): 2
length of query: 277
length of database: 191,569,459
effective HSP length: 116
effective length of query: 161
effective length of database: 128,974,003
effective search space: 20764814483
effective search space used: 20764814483
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)