Citrus Sinensis ID: 023799

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MAQTMLLMSGVSTSHAGNLKRDSLVTFQTQMLRPKPFSHLMFNPLSNESLTAAAASSSSKAFSTVALFKSKTKAPPKTKKPKVEDGIFGTSGGFGFTKQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDEPDEPTGLGGAVIPPGKGLRSALGLKEGGPIFGFTKSNELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGIPINEIEPLVLFNVIFFFVAALNPGTGKFVTDEDEE
cccccccccccccccccccccccHHHHccccccccccccccccccccccHHHcccccccccHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccc
*************************************************************************************GIFGTSGGFGFTKQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVD*******LGGAVIPPGKGLRSALGLKEGGPIFGFTKSNELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGIPINEIEPLVLFNVIFFFVAALNPGTGK********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQTMLLMSGVSTSHAGNLKRDSLVTFQTQMLRPKPFSHLMFNPLSNESLTAAAASSSSKAFSTVALFKSKTKAPPKTKKPKVEDGIFGTSGGFGFTKQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDEPDEPTGLGGAVIPPGKGLRSALGLKEGGPIFGFTKSNELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGIPINEIEPLVLFNVIFFFVAALNPGTGKFVTDEDEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Photosystem II 22 kDa protein, chloroplastic Seems to be involved in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.confidentQ9XF91
Photosystem II 22 kDa protein, chloroplastic Seems to be involved in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.probableQ02060
Photosystem II 22 kDa protein, chloroplastic Seems to be involved in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.probableP54773

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain 3
Confidence level:very confident
Coverage over the Query: 94-235
View the alignment between query and template
View the model in PyMOL