BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023803
(277 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4ITY|A Chain A, Crystal Structure Of Leishmania Mexicana Arginase
pdb|4IU0|A Chain A, Crystal Structure Of Leishmania Mexicana Arginase In
Complex With Inhibitor Abh
pdb|4IU1|A Chain A, Crystal Structure Of Leishmania Mexicana Arginase In
Complex With Inhibitor Nor-noha
pdb|4IU4|A Chain A, Crystal Structure Of Leishmania Mexicana Arginase In
Complex With Inhibitor Bec
pdb|4IU5|A Chain A, Crystal Structure Of Leishmania Mexicana Arginase In
Complex With Catalytic Product L-ornithine
Length = 330
Score = 31.6 bits (70), Expect = 0.46, Method: Compositional matrix adjust.
Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 9/52 (17%)
Query: 139 DIEVFDPILSSTEARVLE--ALGCSVLSVNEQGRRCAIKPTLFYMPHCEAEL 188
D+ +P+L++TE+ V + ++GC++ RC + TL Y PH ++L
Sbjct: 286 DVVECNPLLAATESHVNDTISVGCAI-------ARCMMGETLLYTPHTSSKL 330
>pdb|1EI6|A Chain A, Crystal Structure Of Phosphonoacetate Hydrolase Complexed
With Phosphonoformate
pdb|1EI6|B Chain B, Crystal Structure Of Phosphonoacetate Hydrolase Complexed
With Phosphonoformate
pdb|1EI6|C Chain C, Crystal Structure Of Phosphonoacetate Hydrolase Complexed
With Phosphonoformate
pdb|1EI6|D Chain D, Crystal Structure Of Phosphonoacetate Hydrolase Complexed
With Phosphonoformate
Length = 406
Score = 28.9 bits (63), Expect = 3.1, Method: Compositional matrix adjust.
Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
Query: 161 SVLSVNEQGRRCAIKPTLFY-MPHCEAELYNNLLQANWGAMLKQMVLFGN 209
+++SVN + R + PT+ + CE E N +QA L ++ FG
Sbjct: 2 NLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGT 51
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.136 0.411
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,893,867
Number of Sequences: 62578
Number of extensions: 295183
Number of successful extensions: 677
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 677
Number of HSP's gapped (non-prelim): 3
length of query: 277
length of database: 14,973,337
effective HSP length: 98
effective length of query: 179
effective length of database: 8,840,693
effective search space: 1582484047
effective search space used: 1582484047
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)