BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023815
         (276 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3FIH|K Chain K, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 30s Subunit, Trnas And The Ternary
           Complex.
 pdb|3IY8|K Chain K, Leishmania Tarentolae Mitonchondrial Ribosome Small
           Subunit
 pdb|2WWL|K Chain K, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 30s, The P-Site
           Trna And The Tnac Leader Peptide (Part 1 Of 2).
 pdb|3OFO|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|3OFP|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 pdb|3OFA|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The First 70s Ribosome.
 pdb|3OFB|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The Second 70s Ribosome.
 pdb|3OFX|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|3OFY|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
 pdb|3OAQ|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|3OAR|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 pdb|2YKR|K Chain K, 30s Ribosomal Subunit With Rsga Bound In The Presence Of
           Gmppnp
 pdb|4A2I|K Chain K, Cryo-Electron Microscopy Structure Of The 30s Subunit In
           Complex With The Yjeq Biogenesis Factor
 pdb|3J18|K Chain K, Structure Of The Bacterial Ribosome Complexed By
           Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
           (30s Subunit)
 pdb|4GD1|K Chain K, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|4GD2|K Chain K, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
          Length = 117

 Score = 31.6 bits (70), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 222 VDGDKEYGIRTFSVML-----GKERMIKELLNL-FKNMDLEDESPLPGEGIDKPR 270
            D  KEYGI+   VM+     G+E  I+ L    F+  ++ D +P+P  G   P+
Sbjct: 59  ADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPK 113


>pdb|1VS5|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|1VS7|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|3E1A|C Chain C, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Pre- Accommodation State
 pdb|3E1C|C Chain C, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Post-Accommodation State
 pdb|3I1M|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1O|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1Q|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1S|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1Z|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I21|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3KC4|K Chain K, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
           Ribosomal Subnit. The 50s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kcr
 pdb|3OR9|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The First
           70s Ribosome.
 pdb|3ORA|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 pdb|3IZV|O Chain O, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
           Ef-Tu
 pdb|3IZW|O Chain O, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding.This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A Cognate
           Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 pdb|3SFS|K Chain K, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome
 pdb|3UOQ|K Chain K, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome (Without
           Viomycin)
 pdb|4GAQ|K Chain K, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
 pdb|4GAS|K Chain K, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
          Length = 129

 Score = 31.6 bits (70), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 222 VDGDKEYGIRTFSVML-----GKERMIKELLNL-FKNMDLEDESPLPGEGIDKPR 270
            D  KEYGI+   VM+     G+E  I+ L    F+  ++ D +P+P  G   P+
Sbjct: 71  ADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPK 125


>pdb|2AJF|A Chain A, Structure Of Sars Coronavirus Spike Receptor-Binding
           Domain Complexed With Its Receptor
 pdb|2AJF|B Chain B, Structure Of Sars Coronavirus Spike Receptor-Binding
           Domain Complexed With Its Receptor
 pdb|3KBH|A Chain A, Crystal Structure Of Nl63 Respiratory Coronavirus
           Receptor-Binding Domain Complexed With Its Human
           Receptor
 pdb|3KBH|B Chain B, Crystal Structure Of Nl63 Respiratory Coronavirus
           Receptor-Binding Domain Complexed With Its Human
           Receptor
 pdb|3KBH|C Chain C, Crystal Structure Of Nl63 Respiratory Coronavirus
           Receptor-Binding Domain Complexed With Its Human
           Receptor
 pdb|3KBH|D Chain D, Crystal Structure Of Nl63 Respiratory Coronavirus
           Receptor-Binding Domain Complexed With Its Human
           Receptor
          Length = 597

 Score = 31.6 bits (70), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 26  KSLYRFTRPNTLNGLVIAVTSICCLPLQNLGDLTPTFFMEVFKTVVP 72
           + L+ + R   +N     ++ I CLP   LGD+   F+  ++   VP
Sbjct: 220 EHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVP 266


>pdb|3SCI|A Chain A, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From A Predicted Sars Coronavirus Human Strain Complexed
           With Human Receptor Ace2
 pdb|3SCI|B Chain B, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From A Predicted Sars Coronavirus Human Strain Complexed
           With Human Receptor Ace2
 pdb|3SCJ|A Chain A, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From A Predicted Sars Coronavirus Civet Strain Complexed
           With Human Receptor Ace2
 pdb|3SCJ|B Chain B, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From A Predicted Sars Coronavirus Civet Strain Complexed
           With Human Receptor Ace2
          Length = 603

 Score = 31.6 bits (70), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 26  KSLYRFTRPNTLNGLVIAVTSICCLPLQNLGDLTPTFFMEVFKTVVP 72
           + L+ + R   +N     ++ I CLP   LGD+   F+  ++   VP
Sbjct: 220 EHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVP 266


>pdb|1P6G|K Chain K, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 pdb|1P87|K Chain K, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 pdb|2AVY|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2AW7|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 pdb|2I2P|K Chain K, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2I2U|K Chain K, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QOU|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The First 70s Ribosome,
           With Spectinomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|2QOW|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome, With Spectinomycin Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|2QOY|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QP0|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QAL|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QAN|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QB9|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QBB|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBD|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           First 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBF|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBH|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The First 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2QBJ|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The Second 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4K|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The First 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4M|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The Second 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2VHO|K Chain K, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 3 Of 4)
 pdb|2VHP|K Chain K, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 4 Of 4)
 pdb|3DF1|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|3DF3|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|3J00|K Chain K, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
 pdb|4ADV|K Chain K, Structure Of The E. Coli Methyltransferase Ksga Bound To
           The E. Coli 30s Ribosomal Subunit
 pdb|3J0U|N Chain N, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class2 Of The Six
           Classes)
 pdb|3J0V|N Chain N, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 4a Of The Six
           Classes)
 pdb|3J0X|N Chain N, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 4b Of The Six
           Classes)
 pdb|3J0Z|N Chain N, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 5 Of The Six
           Classes)
 pdb|3J10|N Chain N, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 6 Of The Six
           Classes)
 pdb|3J13|M Chain M, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 3 Of The Six
           Classes)
          Length = 128

 Score = 31.6 bits (70), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 222 VDGDKEYGIRTFSVML-----GKERMIKELLNL-FKNMDLEDESPLPGEGIDKPR 270
            D  KEYGI+   VM+     G+E  I+ L    F+  ++ D +P+P  G   P+
Sbjct: 70  ADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPK 124


>pdb|1R42|A Chain A, Native Human Angiotensin Converting Enzyme-related
           Carboxypeptidase (ace2)
 pdb|1R4L|A Chain A, Inhibitor Bound Human Angiotensin Converting
           Enzyme-Related Carboxypeptidase (Ace2)
          Length = 615

 Score = 31.6 bits (70), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 26  KSLYRFTRPNTLNGLVIAVTSICCLPLQNLGDLTPTFFMEVFKTVVP 72
           + L+ + R   +N     ++ I CLP   LGD+   F+  ++   VP
Sbjct: 238 EHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVP 284


>pdb|2GY9|K Chain K, Structure Of The 30s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 pdb|2GYB|K Chain K, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 116

 Score = 31.6 bits (70), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 222 VDGDKEYGIRTFSVML-----GKERMIKELLNL-FKNMDLEDESPLPGEGIDKPR 270
            D  KEYGI+   VM+     G+E  I+ L    F+  ++ D +P+P  G   P+
Sbjct: 59  ADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPK 113


>pdb|3D0G|A Chain A, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From The 2002-2003 Sars Coronavirus Human Strain
           Complexed With Human-Civet Chimeric Receptor Ace2
 pdb|3D0G|B Chain B, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From The 2002-2003 Sars Coronavirus Human Strain
           Complexed With Human-Civet Chimeric Receptor Ace2
 pdb|3D0H|A Chain A, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From The 2002-2003 Sars Coronavirus Civet Strain
           Complexed With Human-Civet Chimeric Receptor Ace2
 pdb|3D0H|B Chain B, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From The 2002-2003 Sars Coronavirus Civet Strain
           Complexed With Human-Civet Chimeric Receptor Ace2
 pdb|3D0I|A Chain A, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From The 2005-2006 Sars Coronavirus Civet Strain
           Complexed With Human-Civet Chimeric Receptor Ace2
 pdb|3D0I|B Chain B, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From The 2005-2006 Sars Coronavirus Civet Strain
           Complexed With Human-Civet Chimeric Receptor Ace2
          Length = 597

 Score = 31.6 bits (70), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 26  KSLYRFTRPNTLNGLVIAVTSICCLPLQNLGDLTPTFFMEVFKTVVP 72
           + L+ + R   +N     ++ I CLP   LGD+   F+  ++   VP
Sbjct: 220 EHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVP 266


>pdb|3SCK|A Chain A, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From A Predicted Sars Coronavirus Civet Strain Complexed
           With Human-Civet Chimeric Receptor Ace2
 pdb|3SCK|B Chain B, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From A Predicted Sars Coronavirus Civet Strain Complexed
           With Human-Civet Chimeric Receptor Ace2
 pdb|3SCL|A Chain A, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From Sars Coronavirus Epidemic Strain Complexed With
           Human-Civet Chimeric Receptor Ace2
 pdb|3SCL|B Chain B, Crystal Structure Of Spike Protein Receptor-Binding Domain
           From Sars Coronavirus Epidemic Strain Complexed With
           Human-Civet Chimeric Receptor Ace2
          Length = 603

 Score = 31.2 bits (69), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 26  KSLYRFTRPNTLNGLVIAVTSICCLPLQNLGDLTPTFFMEVFKTVVP 72
           + L+ + R   +N     ++ I CLP   LGD+   F+  ++   VP
Sbjct: 220 EHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVP 266


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.142    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,580,746
Number of Sequences: 62578
Number of extensions: 286248
Number of successful extensions: 679
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 674
Number of HSP's gapped (non-prelim): 12
length of query: 276
length of database: 14,973,337
effective HSP length: 97
effective length of query: 179
effective length of database: 8,903,271
effective search space: 1593685509
effective search space used: 1593685509
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)