Citrus Sinensis ID: 023842

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MDETVLDDIIRRLLDAKNGRTTKQVQLTEAEIRQLCAASKEIFLSQPNLLELEAPIKICGDVHGQFSDLLRLFEYGGYPPEANYLFLGDYVDRGKQSIETICLLLAYKVKYKENFFLLRGNHECASINRIYGFYDECKRRFNVRVWKTFTDCFNCLPVAALVDEKILCMHGGLSPDLKNLDQIRNIARPVDVPDQGLLCDLLWADPDKDIEGWGENDRGVSYTFGADKVVEFLQKHDLDLICRAHQILKASEKKGKVGFGNNMLRPGTPPHKGGKG
cccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccEEEEccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHcccHHHHHHHHHHccccccHEEEcccEEEEccccccccccHHHHHccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHccccEEEEcccHHHcccccccccccccEEEEEccccccccc
*DETVLDDIIRRLLDAKNGRTTKQVQLTEAEIRQLCAASKEIFLSQPNLLELEAPIKICGDVHGQFSDLLRLFEYGGYPPEANYLFLGDYVDRGKQSIETICLLLAYKVKYKENFFLLRGNHECASINRIYGFYDECKRRFNVRVWKTFTDCFNCLPVAALVDEKILCMHGGLSPDLKNLDQIRNIARPVDVPDQGLLCDLLWADPDKDIEGWGENDRGVSYTFGADKVVEFLQKHDLDLICRAHQILKASEKKGKVGFGNNMLRPGTPPH*G***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDETVLDDIIRRLLDAKNGRTTKQVQLTEAEIRQLCAASKEIFLSQPNLLELEAPIKICGDVHGQFSDLLRLFEYGGYPPEANYLFLGDYVDRGKQSIETICLLLAYKVKYKENFFLLRGNHECASINRIYGFYDECKRRFNVRVWKTFTDCFNCLPVAALVDEKILCMHGGLSPDLKNLDQIRNIARPVDVPDQGLLCDLLWADPDKDIEGWGENDRGVSYTFGADKVVEFLQKHDLDLICRAHQILKASEKKGKVGFGNNMLRPGTPPHKGGKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase PP1 isozyme 6 confidentP48486
Serine/threonine-protein phosphatase alpha-3 isoform confidentQ05547
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Regulates NEK2 function in terms of kinase activity and centrosome number and splitting, both in the presence and absence of radiation-induced DNA damage. Regulator of neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development.probableQ3T0E7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E7A, chain A
Confidence level:very confident
Coverage over the Query: 4-254
View the alignment between query and template
View the model in PyMOL