Citrus Sinensis ID: 023855


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MSASVNSSSATVNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRQSHQSFFEKSDIFFLCMLRPLSFDIQKQESEIEAAEWMPLEEYAAQPYVQNQELLKYIVDICSAKVDTRGYHGFSPVPTTSAFSDKKHYFYLNSVDLKRH
cccccccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHcccccccccccEEEEEEEcccccccccccccccEEEEEEEEEcccEEEEEEEccccccccccccccEEECcccccHHHHHHHHHHHccccEEEEEEEEEEEEccccccccEEEEEEEEEccccccccccccccccEEECcccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccCEEEEEEccccccc
***********VNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRQSHQSFFEKSDIFFLCMLRPLSFDIQKQESEIEAAEWMPLEEYAAQPYVQNQELLKYIVDICSAKVDTRGYHGFSPVPTTSAFSDKKHYFYLNSVD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSASVNSSSATVNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVLAFRQSHQSFFEKSDIFFLCMLRPLSFDIQKQESEIEAAEWMPLEEYAAQPYVQNQELLKYIVDICSAKVDTRGYHGFSPVPTTSAFSDKKHYFYLNSVDLKRH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nudix hydrolase 2 Probably mediates the hydrolysis of some nucleoside diphosphate derivatives. In vitro, it can use both NADH and ADP-ribose as substrates; however the relevance of such substrates in vivo is unclear.probableQ94B74

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.1.-In phosphorous-containing anhydrides.probable
3.6.1.22NAD(+) diphosphatase.probable
3.6.1.13ADP-ribose diphosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H95, chain A
Confidence level:very confident
Coverage over the Query: 108-240
View the alignment between query and template
View the model in PyMOL
Template: 3FXT, chain A
Confidence level:very confident
Coverage over the Query: 12-96
View the alignment between query and template
View the model in PyMOL
Template: 2FB1, chain A
Confidence level:confident
Coverage over the Query: 100-267
View the alignment between query and template
View the model in PyMOL