Query         023863
Match_columns 276
No_of_seqs    62 out of 64
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 07:12:02 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/023863.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/023863hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02817 E3_binding:  e3 bindin  23.9      52  0.0011   22.6   1.5   17  207-223    21-37  (39)
  2 PF08756 YfkB:  YfkB-like domai  21.2      43 0.00093   29.8   0.8   20   13-33     29-48  (153)
  3 PF06744 DUF1215:  Protein of u  11.6 1.4E+02   0.003   24.4   1.4   20  204-227    55-74  (125)
  4 cd04412 NDPk7B Nucleoside diph  10.3 1.5E+02  0.0032   24.7   1.2   23  206-229     4-26  (134)
  5 PF03785 Peptidase_C25_C:  Pept   9.2 1.8E+02  0.0039   23.5   1.3   24  250-273    46-69  (81)
  6 TIGR00214 lipB lipoate-protein   9.0 1.6E+02  0.0035   26.5   1.0   20  205-224   142-163 (184)
  7 PF03471 CorC_HlyC:  Transporte   8.6 1.9E+02   0.004   21.7   1.1   17  214-230    10-26  (81)
  8 PF00312 Ribosomal_S15:  Riboso   8.5   1E+02  0.0022   24.0  -0.3   10   56-65     55-64  (83)
  9 COG3889 Predicted solute bindi   8.3 2.3E+02   0.005   31.4   2.0   30  196-227   483-513 (872)
 10 COG0184 RpsO Ribosomal protein   8.3 1.2E+02  0.0025   24.7  -0.2   11   56-66     60-70  (89)

No 1  
>PF02817 E3_binding:  e3 binding domain;  InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit. Proteins containing this domain include the branched-chain alpha-keto acid dehydrogenase complex of bacteria, which catalyses the overall conversion of alpha-keto acids to acyl-CoA and carbon dioxide; and the E-3 binding protein of eukaryotic pyruvate dehydrogenase.; GO: 0016746 transferase activity, transferring acyl groups, 0008152 metabolic process; PDB: 1BBL_A 1W4H_A 1BAL_A 2WXC_A 2BTH_A 2BTG_A 2CYU_A 2EQ7_C 2EQ8_C 3RNM_E ....
Probab=23.87  E-value=52  Score=22.65  Aligned_cols=17  Identities=35%  Similarity=0.507  Sum_probs=15.6

Q ss_pred             eeeccCCccCCcchHhH
Q 023863          207 AFIKPCGVHGDITLKDI  223 (276)
Q Consensus       207 ~~vKP~g~~gd~TL~DI  223 (276)
                      +-|++.|.+|-||..||
T Consensus        21 ~~v~gtG~~GrI~k~Dv   37 (39)
T PF02817_consen   21 SQVKGTGPGGRITKEDV   37 (39)
T ss_dssp             GGSSSSSTTSBBCHHHH
T ss_pred             ccccccCCCCcEeHHHh
Confidence            47899999999999998


No 2  
>PF08756 YfkB:  YfkB-like domain;  InterPro: IPR014866 YfkB is adjacent to YfkA in Bacillus subtilis. In other bacterial species, it is fused to this protein. As YfkA contains a Radical SAM domain it suggests this domain is interacts with them. 
Probab=21.19  E-value=43  Score=29.84  Aligned_cols=20  Identities=30%  Similarity=0.413  Sum_probs=16.8

Q ss_pred             CccccccccCCCCcccccCcc
Q 023863           13 GEDLSYMLDDETTPVKACGDL   33 (276)
Q Consensus        13 ~eD~s~~m~~~tTPvk~C~df   33 (276)
                      .+.+.||||| |-|+..|..-
T Consensus        29 Rd~~~WMLFG-TLPfy~Cs~~   48 (153)
T PF08756_consen   29 RDPNVWMLFG-TLPFYPCSDD   48 (153)
T ss_pred             cCCCeeEEec-ccccccCCCC
Confidence            4556899999 8899999876


No 3  
>PF06744 DUF1215:  Protein of unknown function (DUF1215);  InterPro: IPR010623 This domain represents a conserved region situated towards the C-terminal end of several hypothetical bacterial proteins of unknown function. A few members resemble the ImcF protein, which has been proposed [] to be involved in Vibrio cholerae cell surface reorganisation that results in increased adherence to epithelial cells line and increased conjugation frequency.
Probab=11.63  E-value=1.4e+02  Score=24.40  Aligned_cols=20  Identities=30%  Similarity=0.575  Sum_probs=15.5

Q ss_pred             eeeeeeccCCccCCcchHhHHhhh
Q 023863          204 YPFAFIKPCGVHGDITLKDINQRI  227 (276)
Q Consensus       204 yPF~~vKP~g~~gd~TL~DIN~ri  227 (276)
                      |||+    -...-||+|.|+++-.
T Consensus        55 YPF~----~~s~~dv~l~Df~~fF   74 (125)
T PF06744_consen   55 YPFD----PDSSRDVSLADFARFF   74 (125)
T ss_pred             CCCC----CCCcccCCHHHHHHHh
Confidence            9998    3456789999998654


No 4  
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B. The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner.
Probab=10.29  E-value=1.5e+02  Score=24.72  Aligned_cols=23  Identities=35%  Similarity=0.430  Sum_probs=16.1

Q ss_pred             eeeeccCCccCCcchHhHHhhhcC
Q 023863          206 FAFIKPCGVHGDITLKDINQRIHS  229 (276)
Q Consensus       206 F~~vKP~g~~gd~TL~DIN~ri~~  229 (276)
                      |++|||+++.-. -+-.|-++|..
T Consensus         4 l~lIKPda~~~~-~~g~Ii~~i~~   26 (134)
T cd04412           4 VCIIKPHAVSHG-LLGEILQQILD   26 (134)
T ss_pred             EEEECchHhhcC-chHHHHHHHHH
Confidence            789999998654 23567666653


No 5  
>PF03785 Peptidase_C25_C:  Peptidase family C25, C terminal ig-like domain;  InterPro: IPR005536 This domain is found in almost all members of MEROPS peptidase family C25, (clan CD). Peptidase family C25 is a protein family found in the bacteria Porphyromonas gingivalis (Bacteroides gingivalis) a Gram-negative anaerobic bacterial species strongly associated with adult periodontitis. One of its distinguishing characteristics and putative virulence properties is the ability to agglutinate erythrocytes []. It is a highly proteolytic organism which metabolises small peptides and amino acids. Indirect evidence suggests that the proteases produced by this microorganism constitute an important virulence factor []. Protease-encoding genes have been shown to contain multiple copies of repeated nucleotide sequences. These conserved sequences have also been found in haemagglutinin genes [].; GO: 0008233 peptidase activity, 0006508 proteolysis; PDB: 1CVR_A.
Probab=9.20  E-value=1.8e+02  Score=23.52  Aligned_cols=24  Identities=29%  Similarity=0.361  Sum_probs=14.9

Q ss_pred             CCCcceeeeeeeeCCCceeEEEEe
Q 023863          250 SGKPVVGKTKIRTEGGKGSITIMR  273 (276)
Q Consensus       250 SGK~Vv~~tri~T~gg~Gtiti~r  273 (276)
                      ||++++.+++.-|+.|-=++||+|
T Consensus        46 sG~ati~l~~~it~~~~~tlTit~   69 (81)
T PF03785_consen   46 SGNATINLTNPITDEGTLTLTITA   69 (81)
T ss_dssp             TTEEEEE-SS--TT-SEEEEEEE-
T ss_pred             CceEEEECCcccCCCceEEEEEEE
Confidence            999999999766754555666665


No 6  
>TIGR00214 lipB lipoate-protein ligase B. Involved in lipoate biosynthesis as the main determinant of the lipoyl-protein ligase activity required for lipoylation of enzymes such as alpha-ketoacid dehydrogenases. Involved in activation and re-activation (following denaturation) of lipoyl-protein ligases (calcium ion-dependant process).
Probab=9.00  E-value=1.6e+02  Score=26.52  Aligned_cols=20  Identities=40%  Similarity=0.853  Sum_probs=16.6

Q ss_pred             eeeeeccCCccCC--cchHhHH
Q 023863          205 PFAFIKPCGVHGD--ITLKDIN  224 (276)
Q Consensus       205 PF~~vKP~g~~gd--~TL~DIN  224 (276)
                      ||..|.|||+.|-  ++|++++
T Consensus       142 ~F~~I~PCGl~~~~vTSl~~~~  163 (184)
T TIGR00214       142 PFSHINPCGYAGREMGSLNQFL  163 (184)
T ss_pred             HhccEEcCCCCCCcEeeHHHHc
Confidence            6999999999985  5787764


No 7  
>PF03471 CorC_HlyC:  Transporter associated domain;  InterPro: IPR005170 This small domain is found in a family of proteins with the CBS IPR002550 from INTERPRO domain and two CBS domains with this domain found at the C terminus of the proteins, the domain is also found at the C terminus of some Na+/H+ antiporters. This domain is also found in CorC that is involved in Magnesium and cobalt efflux. The function of this domain is uncertain but might be involved in modulating transport of ion substrates.; PDB: 3DED_F 2PLI_C 2R2Z_A 2P4P_A 2O3G_A 2P3H_A 3LLB_A 3LAE_A 2P13_B 2NQW_A ....
Probab=8.64  E-value=1.9e+02  Score=21.65  Aligned_cols=17  Identities=29%  Similarity=0.466  Sum_probs=14.5

Q ss_pred             ccCCcchHhHHhhhcCC
Q 023863          214 VHGDITLKDINQRIHSP  230 (276)
Q Consensus       214 ~~gd~TL~DIN~ri~~~  230 (276)
                      +.|.++|.|+|+.+-..
T Consensus        10 v~G~~~l~~l~~~~~~~   26 (81)
T PF03471_consen   10 VSGSTPLDDLNELLGLD   26 (81)
T ss_dssp             EETTSBHHHHHHHHTS-
T ss_pred             EEecCCHHHHHHHHCcC
Confidence            57999999999998876


No 8  
>PF00312 Ribosomal_S15:  Ribosomal protein S15;  InterPro: IPR000589 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein S15 is one of the proteins from the small ribosomal subunit. In Escherichia coli, this protein binds to 16S ribosomal RNA and functions at early steps in ribosome assembly. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities [, ,], groups bacterial and plant chloroplast S15; archaeal Haloarcula marismortui HmaS15 (HS11); yeast mitochondrial S28; and mammalian, yeast, Brugia pahangi and Wuchereria bancrofti S13. S15 is a protein of 80 to 250 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1YSH_E 3U5C_N 3O30_G 3IZB_O 3O2Z_G 3U5G_N 1S1H_O 3MR8_O 3D5C_O 3MS0_O ....
Probab=8.53  E-value=1e+02  Score=23.99  Aligned_cols=10  Identities=50%  Similarity=0.913  Sum_probs=8.5

Q ss_pred             Hhhhhhcccc
Q 023863           56 QIKRRRMLQF   65 (276)
Q Consensus        56 ~sKRRRmLqF   65 (276)
                      .+||||||.|
T Consensus        55 v~kRrrlL~Y   64 (83)
T PF00312_consen   55 VSKRRRLLKY   64 (83)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHH
Confidence            3899999987


No 9  
>COG3889 Predicted solute binding protein [General function prediction only]
Probab=8.34  E-value=2.3e+02  Score=31.42  Aligned_cols=30  Identities=43%  Similarity=0.489  Sum_probs=24.6

Q ss_pred             ccccceeeeeeeeeccCCccCC-cchHhHHhhh
Q 023863          196 TKLASSVAYPFAFIKPCGVHGD-ITLKDINQRI  227 (276)
Q Consensus       196 ~~~~~~vayPF~~vKP~g~~gd-~TL~DIN~ri  227 (276)
                      .|...+|.|||-.=|  |.||- +||+||=.-|
T Consensus       483 ekAk~kV~~~~~~~k--WhDGq~itlaDil~~~  513 (872)
T COG3889         483 EKAKIKVTYPFLDAK--WHDGQPITLADILKLI  513 (872)
T ss_pred             CeeeeEEEEEecccc--ccCCCccCHHHHHHHH
Confidence            677889999987766  89996 9999996544


No 10 
>COG0184 RpsO Ribosomal protein S15P/S13E [Translation, ribosomal structure and biogenesis]
Probab=8.32  E-value=1.2e+02  Score=24.72  Aligned_cols=11  Identities=45%  Similarity=0.709  Sum_probs=9.2

Q ss_pred             Hhhhhhccccc
Q 023863           56 QIKRRRMLQFD   66 (276)
Q Consensus        56 ~sKRRRmLqF~   66 (276)
                      .+||||+|-|=
T Consensus        60 vskrrrLl~Yl   70 (89)
T COG0184          60 VSKRRRLLKYL   70 (89)
T ss_pred             HHHHHHHHHHH
Confidence            48999999884


Done!