BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023868
         (276 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q28983|ZAN_PIG Zonadhesin OS=Sus scrofa GN=ZAN PE=1 SV=1
          Length = 2476

 Score = 32.0 bits (71), Expect = 5.3,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 27  QKPTISL--SAFPRRRPLIEPYCLAQAQEPTTNITAPTTSEEGPVELPQSIFATTDEPSS 84
           +KPTI    S  P ++P +        + PT     PTT  EGP   P+     T+ P+S
Sbjct: 363 EKPTIPTEKSTVPTKKPTVFKEPTLPPEGPTVPAERPTTPPEGPAVPPKGPTVLTEWPTS 422


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.314    0.128    0.349 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 86,722,677
Number of Sequences: 539616
Number of extensions: 3210647
Number of successful extensions: 9674
Number of sequences better than 100.0: 18
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 9603
Number of HSP's gapped (non-prelim): 79
length of query: 276
length of database: 191,569,459
effective HSP length: 116
effective length of query: 160
effective length of database: 128,974,003
effective search space: 20635840480
effective search space used: 20635840480
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 60 (27.7 bits)