BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023878
(276 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2UU7|A Chain A, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|B Chain B, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|C Chain C, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|D Chain D, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|E Chain E, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|F Chain F, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|G Chain G, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|H Chain H, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|I Chain I, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|J Chain J, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|K Chain K, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|L Chain L, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|M Chain M, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|N Chain N, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
pdb|2UU7|O Chain O, Crystal Structure Of Apo Glutamine Synthetase From Dog (
Canis Familiaris)
Length = 381
Score = 32.0 bits (71), Expect = 0.34, Method: Compositional matrix adjust.
Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
Query: 109 GKDIMKKHRRQVLFSGIITAVGISLHNFPEGMAVFLGSMKGLRVGLNLAVA-IALHNIPE 167
G+DI++ H R L++GI A G + P +G +G+ +G +L VA LH + E
Sbjct: 172 GRDIVEAHYRACLYAGIKIA-GTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCE 230
Query: 168 GVAV 171
V
Sbjct: 231 DFGV 234
>pdb|2OJW|A Chain A, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Phosphate
pdb|2OJW|B Chain B, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Phosphate
pdb|2OJW|C Chain C, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Phosphate
pdb|2OJW|D Chain D, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Phosphate
pdb|2OJW|E Chain E, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Phosphate
pdb|2QC8|A Chain A, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Methionine Sulfoximine Phosphate
pdb|2QC8|B Chain B, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Methionine Sulfoximine Phosphate
pdb|2QC8|C Chain C, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Methionine Sulfoximine Phosphate
pdb|2QC8|D Chain D, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Methionine Sulfoximine Phosphate
pdb|2QC8|E Chain E, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Methionine Sulfoximine Phosphate
pdb|2QC8|F Chain F, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Methionine Sulfoximine Phosphate
pdb|2QC8|G Chain G, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Methionine Sulfoximine Phosphate
pdb|2QC8|H Chain H, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Methionine Sulfoximine Phosphate
pdb|2QC8|I Chain I, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Methionine Sulfoximine Phosphate
pdb|2QC8|J Chain J, Crystal Structure Of Human Glutamine Synthetase In Complex
With Adp And Methionine Sulfoximine Phosphate
Length = 384
Score = 31.6 bits (70), Expect = 0.54, Method: Compositional matrix adjust.
Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
Query: 109 GKDIMKKHRRQVLFSGIITAVGISLHNFPEGMAVFLGSMKGLRVGLNLAVA-IALHNIPE 167
G+DI++ H R L++G+ A G + P +G +G+ +G +L VA LH + E
Sbjct: 191 GRDIVEAHYRACLYAGVKIA-GTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCE 249
Query: 168 GVAV 171
V
Sbjct: 250 DFGV 253
>pdb|3C02|A Chain A, X-Ray Structure Of The Aquaglyceroporin From Plasmodium
Falciparum
Length = 258
Score = 28.1 bits (61), Expect = 5.0, Method: Compositional matrix adjust.
Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 3/45 (6%)
Query: 139 GMAVFLGSMKGLRVG---LNLAVAIALHNIPEGVAVALPVYFATQ 180
G+AVF G + ++ LNLAV+I L +I + +PVYF Q
Sbjct: 51 GLAVFFGILVSAKLSGAHLNLAVSIGLSSINKFDLKKIPVYFFAQ 95
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.140 0.403
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,925,303
Number of Sequences: 62578
Number of extensions: 276033
Number of successful extensions: 738
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 737
Number of HSP's gapped (non-prelim): 5
length of query: 276
length of database: 14,973,337
effective HSP length: 97
effective length of query: 179
effective length of database: 8,903,271
effective search space: 1593685509
effective search space used: 1593685509
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)