BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023879
         (276 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin
          Length = 237

 Score = 27.3 bits (59), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%)

Query: 44  QFNGRQFTVRRRSFVLPSKATTDQQGQVEGDEVVDSKILQYCSIDK 89
            F+  QF+   +  +L S ATTD  G +E  +V  S   Q  S+ +
Sbjct: 127 HFSFNQFSQNPKDLILQSDATTDSDGNLELTKVSSSGDPQGSSVGR 172


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.134    0.370 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,919,379
Number of Sequences: 62578
Number of extensions: 259369
Number of successful extensions: 747
Number of sequences better than 100.0: 28
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 22
Number of HSP's that attempted gapping in prelim test: 740
Number of HSP's gapped (non-prelim): 29
length of query: 276
length of database: 14,973,337
effective HSP length: 97
effective length of query: 179
effective length of database: 8,903,271
effective search space: 1593685509
effective search space used: 1593685509
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)