Query         023884
Match_columns 276
No_of_seqs    224 out of 1123
Neff          5.3 
Searched_HMMs 46136
Date          Fri Mar 29 07:21:15 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/023884.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/023884hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0704 ADP-ribosylation facto 100.0 4.6E-71 9.9E-76  516.7  13.7  215    3-275     6-221 (386)
  2 COG5347 GTPase-activating prot 100.0 1.2E-38 2.7E-43  299.8  10.0  118    3-120     7-125 (319)
  3 KOG0706 Predicted GTPase-activ 100.0 6.3E-38 1.4E-42  301.4   9.9  113    3-116    10-122 (454)
  4 PLN03114 ADP-ribosylation fact 100.0 1.5E-37 3.2E-42  293.1  10.8  114    4-117    10-123 (395)
  5 PF01412 ArfGap:  Putative GTPa 100.0 2.1E-36 4.5E-41  247.2   8.7  114    5-122     2-115 (116)
  6 KOG0703 Predicted GTPase-activ 100.0 7.3E-36 1.6E-40  275.9   7.8  115    3-124    12-127 (287)
  7 smart00105 ArfGap Putative GTP 100.0 1.1E-34 2.3E-39  235.9   9.5  107   14-123     1-107 (112)
  8 PLN03119 putative ADP-ribosyla 100.0   2E-29 4.4E-34  248.7  10.3  115    3-123    10-124 (648)
  9 PLN03131 hypothetical protein; 100.0 2.2E-29 4.7E-34  250.1   9.7  114    3-122    10-123 (705)
 10 KOG0705 GTPase-activating prot  99.9 3.6E-22 7.8E-27  197.5   7.6  113    4-123   501-616 (749)
 11 KOG0521 Putative GTPase activa  99.8 1.2E-20 2.6E-25  195.5   2.5   81    7-87    417-497 (785)
 12 KOG0818 GTPase-activating prot  99.7 1.2E-17 2.6E-22  163.6   3.9  108   12-123     4-119 (669)
 13 KOG1117 Rho- and Arf-GTPase ac  99.6 4.8E-16   1E-20  159.4   3.2   94    9-102   291-398 (1186)
 14 KOG0702 Predicted GTPase-activ  99.4 3.2E-13 6.9E-18  132.5   6.6  117    4-124    13-130 (524)
 15 KOG0521 Putative GTPase activa  91.9   0.042 9.1E-07   58.4  -0.3   69   12-82    626-695 (785)
 16 PRK00085 recO DNA repair prote  85.0    0.61 1.3E-05   42.0   2.2   39    6-44    139-178 (247)
 17 TIGR00613 reco DNA repair prot  78.3     1.6 3.5E-05   39.0   2.5   40    6-45    137-177 (241)
 18 PF00643 zf-B_box:  B-box zinc   75.4     2.7 5.7E-05   27.7   2.3   34   15-48      2-36  (42)
 19 COG1997 RPL43A Ribosomal prote  73.5     3.2   7E-05   32.9   2.6   41    3-45     21-62  (89)
 20 PRK12495 hypothetical protein;  73.5     2.5 5.5E-05   38.8   2.4   29   13-45     39-67  (226)
 21 COG1381 RecO Recombinational D  70.4     2.5 5.4E-05   38.9   1.7   37    7-43    145-182 (251)
 22 PRK11019 hypothetical protein;  66.3       2 4.3E-05   34.0   0.1   37   15-52     35-73  (88)
 23 PF08271 TF_Zn_Ribbon:  TFIIB z  63.5       4 8.7E-05   27.4   1.2   26   18-44      2-27  (43)
 24 PF00320 GATA:  GATA zinc finge  63.4     4.8  0.0001   26.3   1.5   32   19-50      1-34  (36)
 25 smart00401 ZnF_GATA zinc finge  62.0     7.6 0.00016   27.5   2.4   38   15-52      2-41  (52)
 26 PF10764 Gin:  Inhibitor of sig  59.1     5.5 0.00012   27.8   1.3   26   18-44      1-26  (46)
 27 PF01286 XPA_N:  XPA protein N-  55.5     4.4 9.6E-05   26.7   0.3   27   17-43      4-31  (34)
 28 TIGR02419 C4_traR_proteo phage  54.8     5.3 0.00011   29.5   0.6   35   12-46     27-62  (63)
 29 PF11781 RRN7:  RNA polymerase   54.2     9.3  0.0002   25.2   1.6   27   14-43      6-32  (36)
 30 PTZ00255 60S ribosomal protein  51.0      15 0.00033   29.3   2.7   39    3-43     22-61  (90)
 31 cd07171 NR_DBD_ER DNA-binding   50.5      11 0.00023   29.2   1.7   31   15-48      2-32  (82)
 32 PRK13715 conjugal transfer pro  46.0     8.6 0.00019   29.3   0.6   33   16-48     34-67  (73)
 33 PF01258 zf-dskA_traR:  Prokary  45.2     3.5 7.6E-05   26.8  -1.5   29   18-46      5-34  (36)
 34 cd06968 NR_DBD_ROR DNA-binding  44.2      15 0.00032   29.2   1.7   31   15-48      4-34  (95)
 35 cd07170 NR_DBD_ERR DNA-binding  43.8      14  0.0003   29.6   1.5   30   16-48      4-33  (97)
 36 PTZ00218 40S ribosomal protein  42.8      10 0.00022   27.5   0.5   39   14-57     14-52  (54)
 37 KOG0457 Histone acetyltransfer  42.2      22 0.00047   35.8   2.8   63   12-74      9-86  (438)
 38 PHA00080 DksA-like zinc finger  41.0      15 0.00032   27.9   1.2   34   13-47     28-63  (72)
 39 COG1734 DksA DnaK suppressor p  40.9     9.4  0.0002   31.8   0.1   30   18-47     82-112 (120)
 40 cd07173 NR_DBD_AR DNA-binding   40.8      18 0.00038   28.0   1.6   31   15-48      2-32  (82)
 41 PF07282 OrfB_Zn_ribbon:  Putat  40.7      15 0.00032   26.7   1.1   27   15-43     27-53  (69)
 42 PF12760 Zn_Tnp_IS1595:  Transp  40.7      30 0.00066   23.5   2.6   39    3-43      6-44  (46)
 43 COG2158 Uncharacterized protei  40.3      11 0.00023   31.1   0.3   25   28-52     52-78  (112)
 44 cd07160 NR_DBD_LXR DNA-binding  39.8      20 0.00044   28.8   1.9   31   15-48     17-47  (101)
 45 cd07169 NR_DBD_GCNF_like DNA-b  38.9      21 0.00045   28.1   1.8   32   14-48      4-35  (90)
 46 cd06966 NR_DBD_CAR DNA-binding  38.5      15 0.00033   29.0   1.0   29   17-48      1-29  (94)
 47 PF01780 Ribosomal_L37ae:  Ribo  38.2      17 0.00037   29.0   1.2   39    3-43     21-60  (90)
 48 PF14803 Nudix_N_2:  Nudix N-te  37.3      13 0.00027   24.4   0.3   30   17-47      1-33  (34)
 49 KOG3362 Predicted BBOX Zn-fing  35.8      16 0.00035   31.7   0.7   34   14-48    116-150 (156)
 50 PRK00423 tfb transcription ini  35.4      23  0.0005   33.5   1.8   33   13-46      8-40  (310)
 51 KOG3507 DNA-directed RNA polym  34.6      19  0.0004   26.8   0.8   22   18-42     22-43  (62)
 52 cd00202 ZnF_GATA Zinc finger D  34.0      26 0.00057   25.0   1.5   34   18-51      1-36  (54)
 53 TIGR00382 clpX endopeptidase C  32.7      23 0.00049   35.3   1.3   30   15-44      6-37  (413)
 54 cd07161 NR_DBD_EcR DNA-binding  32.2      29 0.00064   27.3   1.6   29   17-48      2-30  (91)
 55 cd07162 NR_DBD_PXR DNA-binding  31.9      31 0.00067   26.8   1.7   28   18-48      1-28  (87)
 56 cd06956 NR_DBD_RXR DNA-binding  31.6      33  0.0007   26.0   1.8   28   18-48      2-29  (77)
 57 smart00290 ZnF_UBP Ubiquitin C  31.0      38 0.00082   22.9   1.9   22   18-39      1-22  (50)
 58 cd07166 NR_DBD_REV_ERB DNA-bin  30.9      25 0.00054   27.5   1.0   30   16-48      3-32  (89)
 59 cd07163 NR_DBD_TLX DNA-binding  30.8      23  0.0005   27.9   0.8   30   16-48      6-35  (92)
 60 TIGR02890 spore_yteA sporulati  30.5      23 0.00051   30.7   0.9   41    6-48     77-119 (159)
 61 cd07172 NR_DBD_GR_PR DNA-bindi  30.2      33 0.00072   26.1   1.6   29   17-48      3-31  (78)
 62 PF10281 Ish1:  Putative stress  30.0      65  0.0014   21.0   2.8   21   62-93      2-22  (38)
 63 COG2174 RPL34A Ribosomal prote  29.7      37  0.0008   27.2   1.8   34   11-44     29-79  (93)
 64 cd07156 NR_DBD_VDR_like The DN  29.5      35 0.00076   25.5   1.6   27   19-48      1-27  (72)
 65 PF14471 DUF4428:  Domain of un  29.3      20 0.00044   25.3   0.2   43   18-61      1-45  (51)
 66 PRK10778 dksA RNA polymerase-b  29.1      35 0.00076   29.4   1.7   38   12-49    107-145 (151)
 67 PF14376 Haem_bd:  Haem-binding  29.1      28  0.0006   29.3   1.1   14   17-30     42-55  (137)
 68 smart00782 PhnA_Zn_Ribbon PhnA  28.7      34 0.00074   24.0   1.3   34   10-44      2-44  (47)
 69 cd06955 NR_DBD_VDR DNA-binding  28.6      28  0.0006   28.4   1.0   31   15-48      5-35  (107)
 70 cd07165 NR_DBD_DmE78_like DNA-  28.4      31 0.00068   26.4   1.2   27   19-48      1-27  (81)
 71 cd07158 NR_DBD_Ppar_like The D  27.9      35 0.00076   25.4   1.4   27   19-48      1-27  (73)
 72 cd06965 NR_DBD_Ppar DNA-bindin  27.8      30 0.00065   26.7   1.0   27   19-48      2-28  (84)
 73 cd07168 NR_DBD_DHR4_like DNA-b  27.0      46   0.001   26.0   1.9   31   15-48      5-35  (90)
 74 cd07179 2DBD_NR_DBD2 The secon  26.8      40 0.00087   25.3   1.5   27   19-48      1-27  (74)
 75 PF06689 zf-C4_ClpX:  ClpX C4-t  26.6      53  0.0012   22.0   1.9   28   17-44      2-32  (41)
 76 COG0675 Transposase and inacti  25.7      28  0.0006   31.6   0.5   22   16-44    309-330 (364)
 77 TIGR00280 L37a ribosomal prote  25.3      64  0.0014   25.8   2.4   39    3-43     21-60  (91)
 78 cd07157 2DBD_NR_DBD1 The first  25.1      31 0.00066   26.8   0.6   28   18-48      2-29  (86)
 79 smart00399 ZnF_C4 c4 zinc fing  24.9      39 0.00084   24.9   1.1   27   19-48      2-28  (70)
 80 cd06962 NR_DBD_FXR DNA-binding  24.2      35 0.00075   26.4   0.8   29   17-48      2-30  (84)
 81 KOG1560 Translation initiation  24.2      71  0.0015   30.8   2.9   25  215-239   257-282 (339)
 82 cd06967 NR_DBD_TR2_like DNA-bi  23.7      36 0.00079   26.5   0.8   30   16-48      3-32  (87)
 83 PRK03976 rpl37ae 50S ribosomal  23.7      61  0.0013   25.9   2.0   39    3-43     22-61  (90)
 84 PF00105 zf-C4:  Zinc finger, C  23.6      51  0.0011   24.1   1.5   26   17-45      1-26  (70)
 85 cd07155 NR_DBD_ER_like DNA-bin  23.4      43 0.00092   25.2   1.1   27   19-48      1-27  (75)
 86 cd06958 NR_DBD_COUP_TF DNA-bin  23.0      45 0.00098   24.9   1.2   27   19-48      1-27  (73)
 87 PF06827 zf-FPG_IleRS:  Zinc fi  22.9      30 0.00064   21.3   0.1   28   17-44      2-29  (30)
 88 smart00659 RPOLCX RNA polymera  22.8      38 0.00082   23.3   0.6   23   18-43      4-26  (44)
 89 cd06960 NR_DBD_HNF4A DNA-bindi  22.7      44 0.00095   25.1   1.1   27   19-48      1-27  (76)
 90 PF13119 DUF3973:  Domain of un  22.4      37  0.0008   23.2   0.5   13   37-49      2-14  (41)
 91 PRK05766 rps14P 30S ribosomal   22.3      24 0.00051   25.3  -0.5   38   15-57     13-50  (52)
 92 cd07164 NR_DBD_PNR_like_1 DNA-  22.1      49  0.0011   25.1   1.2   27   19-48      1-27  (78)
 93 cd06959 NR_DBD_EcR_like The DN  21.8      56  0.0012   24.4   1.5   27   19-48      2-28  (73)
 94 PHA02942 putative transposase;  21.8      41 0.00089   33.0   0.9   26   16-44    325-350 (383)
 95 cd06963 NR_DBD_GR_like The DNA  21.7      56  0.0012   24.5   1.4   27   19-48      1-27  (73)
 96 PRK03681 hypA hydrogenase nick  21.7      28 0.00062   28.4  -0.2   33   11-46     65-97  (114)
 97 KOG1597 Transcription initiati  21.0      61  0.0013   31.2   1.9   28   17-44      1-29  (308)
 98 cd06961 NR_DBD_TR DNA-binding   20.4      50  0.0011   25.5   0.9   27   19-48      2-28  (85)
 99 PHA02540 61 DNA primase; Provi  20.2      62  0.0013   31.5   1.7   58   15-76     26-91  (337)

No 1  
>KOG0704 consensus ADP-ribosylation factor GTPase activator [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]
Probab=100.00  E-value=4.6e-71  Score=516.67  Aligned_cols=215  Identities=58%  Similarity=0.975  Sum_probs=183.0

Q ss_pred             HHHHHHHHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHH
Q 023884            3 ATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNT   82 (276)
Q Consensus         3 a~~~L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~   82 (276)
                      +|+.|++|+...+|++||||+++||||||++|||||||+|+|+||+||||||||||||||+|++.||++|++|||.++++
T Consensus         6 trr~L~~lkp~deNk~CfeC~a~NPQWvSvsyGIfICLECSG~HRgLGVhiSFVRSVTMD~wkeiel~kMeaGGN~~~~e   85 (386)
T KOG0704|consen    6 TRRVLLELKPQDENKKCFECGAPNPQWVSVSYGIFICLECSGKHRGLGVHISFVRSVTMDKWKEIELKKMEAGGNERFRE   85 (386)
T ss_pred             HHHHHHhcCccccCCceeecCCCCCCeEeecccEEEEEecCCcccccceeeEEEEeeecccccHHHHHHHHhccchhHHH
Confidence            77888888888899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCCCC-ChhhhccchHHHHHHHHHHHHHcCCCCCCCCchhhhhccCCCCCCCCCcCCCCCCCCCCCCCCCCCCC
Q 023884           83 FLSQYGIPKET-DIVTKYNTNAASIYRDRIQAIAEGRPWRDPPVVKETLNAGKSSSRPPLAQSASVGGVGRNGNYGNHGG  161 (276)
Q Consensus        83 ~~e~~~~~~~~-~i~~KY~s~aa~~yr~kl~~~~egr~~~~~p~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (276)
                      ||+.+++-++. +|++||++++|++||+||++++|||+|.+||.++|..++  +..++.      +.             
T Consensus        86 FL~s~~~~~e~~~i~eKYns~aAa~yRdki~~laegr~w~d~~~~k~~~p~--~syt~a------~~-------------  144 (386)
T KOG0704|consen   86 FLSSQGIYKETWPIREKYNSRAAALYRDKIAALAEGREWNDPPYLKEDNPA--QSYTSA------AQ-------------  144 (386)
T ss_pred             HHhhCccccccccHHHhhccHHHHHHHHHHHHHhcCCcccccccccccCcc--cccccC------CC-------------
Confidence            99999876665 999999999999999999999999999999999887531  111110      00             


Q ss_pred             CCCCCCCCCCCcccccccCCcCCCCCCCCCCCCCCCCCCCchhhhhhHHHHHHHhhhhhhhhHHHhhhhhcCCCCCCCCC
Q 023884          162 WDSWDNDDFRSSNDMRRNQSVSDFRGGSGGMGGMPASRSKSTEDIYTRAELEASAANKEGFFSRKIAENEARPEGLPPSQ  241 (276)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~yFa~~~~~Na~rp~~lppsQ  241 (276)
                                                          ..+.++..+|+..|.+++++.+|.||++++.+|++|||+|||||
T Consensus       145 ------------------------------------~~~~ss~~~~~~sq~~~~~~~ke~~fa~~~~~n~srpd~lppsQ  188 (386)
T KOG0704|consen  145 ------------------------------------LGSKSSETIYTISQLSNSAAGKESYFAKRLSENQSRPDGLPPSQ  188 (386)
T ss_pred             ------------------------------------cCCCcCCcccccccchhhhcchhHHHHHhcccccCCCCCCCccc
Confidence                                                00011112234445566778999999999999999999999999


Q ss_pred             CCcccccCCCCCCCCCCCCcccChhhhhhhcccC
Q 023884          242 GGKYVGFGSTPPPTQRNTNSQGDVLSAVSQVIDG  275 (276)
Q Consensus       242 ggkY~GFG~~p~~~~~~~~~~~d~~~~l~~g~~~  275 (276)
                      ||||+|||+|+.|||+.+. ++|+|++|++||++
T Consensus       189 ggkY~GFGst~~~ppqs~~-~~~~~s~ls~Gws~  221 (386)
T KOG0704|consen  189 GGKYQGFGSTNAPPPQSNS-QDDAMSVLSSGWSR  221 (386)
T ss_pred             CCcccccCCCCCCCCcccc-ccchhhhhcccccc
Confidence            9999999999877776432 33899999999986


No 2  
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=100.00  E-value=1.2e-38  Score=299.82  Aligned_cols=118  Identities=39%  Similarity=0.727  Sum_probs=111.3

Q ss_pred             HHHHHHHHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHH
Q 023884            3 ATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNT   82 (276)
Q Consensus         3 a~~~L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~   82 (276)
                      .+++|..|++.++|++|||||+++|+|||++||||||++||||||+|||||||||||+||.|+++||++|+.+||.++++
T Consensus         7 ~~~~l~~l~~~~~Nk~CaDCga~~P~W~S~nlGvfiCi~CagvHRsLGvhiS~VKSitLD~wt~~~l~~m~~gGN~~a~~   86 (319)
T COG5347           7 DRKLLKLLKSDSSNKKCADCGAPNPTWASVNLGVFLCIDCAGVHRSLGVHISKVKSLTLDNWTEEELRRMEVGGNSNANR   86 (319)
T ss_pred             HHHHHHHHhhccccCccccCCCCCCceEecccCeEEEeecchhhhccccceeeeeeeecccCCHHHHHHHHHhcchhhhh
Confidence            57788889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCC-CCChhhhccchHHHHHHHHHHHHHcCCCC
Q 023884           83 FLSQYGIPK-ETDIVTKYNTNAASIYRDRIQAIAEGRPW  120 (276)
Q Consensus        83 ~~e~~~~~~-~~~i~~KY~s~aa~~yr~kl~~~~egr~~  120 (276)
                      ||+.+++.. ..+|++||++.+++.|++++..+.....|
T Consensus        87 ~~e~~~~~~~~~~~k~~yd~~v~~~y~~~ky~~~~~~~~  125 (319)
T COG5347          87 FYEKNLLDQLLLPIKAKYDSSVAKKYIRKKYELKKFIDD  125 (319)
T ss_pred             HhccCCCcccccccccccCHHHHHHHHHHHHHhhhcccc
Confidence            999998874 47899999999999999998888877766


No 3  
>KOG0706 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=100.00  E-value=6.3e-38  Score=301.38  Aligned_cols=113  Identities=47%  Similarity=0.938  Sum_probs=107.1

Q ss_pred             HHHHHHHHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHH
Q 023884            3 ATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNT   82 (276)
Q Consensus         3 a~~~L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~   82 (276)
                      ...+++.|+..+.||+||||+++||.|+||+||||||++|+++||.||||||||||+.||.|+.+||++|+.|||.+++.
T Consensus        10 ~~~vfkkLRs~~~NKvCFDCgAknPtWaSVTYGIFLCiDCSAvHRnLGVHiSFVRSTnLDsWs~~qLR~M~~GGN~nA~~   89 (454)
T KOG0706|consen   10 IQTVFKKLRSQSENKVCFDCGAKNPTWASVTYGIFLCIDCSAVHRNLGVHISFVRSTNLDSWSWEQLRRMQVGGNANARV   89 (454)
T ss_pred             HHHHHHHHhcCCCCceecccCCCCCCceeecceEEEEEecchhhhccccceEEEeecccccCCHHHHhHhhhcCchhHHH
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCCCCChhhhccchHHHHHHHHHHHHHc
Q 023884           83 FLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAE  116 (276)
Q Consensus        83 ~~e~~~~~~~~~i~~KY~s~aa~~yr~kl~~~~e  116 (276)
                      ||.+|+... .+++.||++++|..||++|..++.
T Consensus        90 FFkqhg~~t-~d~~aKY~SraA~~Yr~kl~~lv~  122 (454)
T KOG0706|consen   90 FFKQHGCVT-LDANAKYNSRAAKLYREKLKKLVQ  122 (454)
T ss_pred             HHHHcCCcc-hhhhhhhccHHHHHHHHHHHHHHH
Confidence            999998764 389999999999999999987664


No 4  
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=100.00  E-value=1.5e-37  Score=293.07  Aligned_cols=114  Identities=46%  Similarity=0.885  Sum_probs=109.5

Q ss_pred             HHHHHHHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHHH
Q 023884            4 TRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNTF   83 (276)
Q Consensus         4 ~~~L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~~   83 (276)
                      .++|++|+..|+|++|+||++++|+|||++||||||++|+|+||.||+||||||||+||.|+++||++|+.+||.++++|
T Consensus        10 ~~vfrkL~~kPgNk~CaDCga~nPtWASvn~GIFLCl~CSGVHRsLGvHISfVRSltLD~Ws~eqL~~Mk~GGN~rA~~f   89 (395)
T PLN03114         10 ISVFKKLKAKSDNKICFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSSEQLKMMIYGGNNRAQVF   89 (395)
T ss_pred             HHHHHHHHhCcCCCcCccCCCCCCCceeeccceeehhhhhHhhccCCCCCceeecccCCCCCHHHHHHHHHhcCHHHHHH
Confidence            45699999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhcCCCCCCChhhhccchHHHHHHHHHHHHHcC
Q 023884           84 LSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEG  117 (276)
Q Consensus        84 ~e~~~~~~~~~i~~KY~s~aa~~yr~kl~~~~eg  117 (276)
                      |++|++.....|++||++++|+.||++|.+++++
T Consensus        90 F~qhG~~~~~~~~~KY~S~aA~~Yre~L~keVa~  123 (395)
T PLN03114         90 FKQYGWSDGGKTEAKYTSRAADLYKQILAKEVAK  123 (395)
T ss_pred             HHHcCCCCCCCcccccCCHHHHHHHHHHHHHHHH
Confidence            9999998778899999999999999999988765


No 5  
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=100.00  E-value=2.1e-36  Score=247.15  Aligned_cols=114  Identities=41%  Similarity=0.810  Sum_probs=90.2

Q ss_pred             HHHHHHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHHHH
Q 023884            5 RRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNTFL   84 (276)
Q Consensus         5 ~~L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~~~   84 (276)
                      ++|+.|++.|+|++|+|||+++|+|||++||||||++|+++||.||+|||+||||+||.|+++||++|+.+||..+|++|
T Consensus         2 ~~l~~l~~~~~N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~lg~~is~VkSi~~d~w~~~ev~~~~~~GN~~~n~~~   81 (116)
T PF01412_consen    2 KILRELLKKPGNKVCADCGAPNPTWASLNYGIFLCLECAGIHRSLGVHISRVKSITMDNWSPEEVQRMREGGNKRANSIW   81 (116)
T ss_dssp             HHHHHHHCSTTCTB-TTT-SBS--EEETTTTEEE-HHHHHHHHHHTTTT--EEETTTS---HHHHHHHHHSHHHHHHHHH
T ss_pred             HHHHHHHcCcCcCcCCCCCCCCCCEEEeecChhhhHHHHHHHHHhcccchhccccccCCCCHHHHHHHHHHChHHHHHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCCCCCChhhhccchHHHHHHHHHHHHHcCCCCCC
Q 023884           85 SQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPWRD  122 (276)
Q Consensus        85 e~~~~~~~~~i~~KY~s~aa~~yr~kl~~~~egr~~~~  122 (276)
                      +++. +..   ...-.......|+++|+++|+.+.|..
T Consensus        82 e~~~-~~~---~~~~~~~~~~~~~~fI~~KY~~k~f~~  115 (116)
T PF01412_consen   82 EANS-PPP---KKPPPSSDQEKREQFIRAKYVEKAFIS  115 (116)
T ss_dssp             TTTS-TTT---TTHCTTSHHHHHHHHHHHHHTTHTTS-
T ss_pred             HcCC-CCC---CCCCCCCcHHHHHHHHHHHHHhhhhcc
Confidence            9771 111   111123345678889999999999975


No 6  
>KOG0703 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=100.00  E-value=7.3e-36  Score=275.91  Aligned_cols=115  Identities=41%  Similarity=0.815  Sum_probs=100.0

Q ss_pred             HHHHHHHHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHH
Q 023884            3 ATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNT   82 (276)
Q Consensus         3 a~~~L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~   82 (276)
                      .+++|++|++.|+|+.|+||+++.|.|||+++|||||+.|+||||.||||||+||||+||.|++|||+.|+..||.++|+
T Consensus        12 ~~~~l~~Ll~~~~N~~CADC~a~~P~WaSwnlGvFiC~~C~giHR~lg~hiSkVkSv~LD~W~~eqv~~m~~~GN~~an~   91 (287)
T KOG0703|consen   12 NKRRLRELLREPDNKVCADCGAKGPRWASWNLGVFICLRCAGIHRSLGVHISKVKSVTLDEWTDEQVDFMISMGNAKANS   91 (287)
T ss_pred             HHHHHHHHHcCcccCcccccCCCCCCeEEeecCeEEEeecccccccccchhheeeeeeccccCHHHHHHHHHHcchhhhh
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCCCCChhhhccchHHH-HHHHHHHHHHcCCCCCCCC
Q 023884           83 FLSQYGIPKETDIVTKYNTNAAS-IYRDRIQAIAEGRPWRDPP  124 (276)
Q Consensus        83 ~~e~~~~~~~~~i~~KY~s~aa~-~yr~kl~~~~egr~~~~~p  124 (276)
                      |||+. ++..      |...-.. ..-.+|+++||-++|+++.
T Consensus        92 ~~ea~-~p~~------~~~p~~d~~~e~FIR~KYE~kkf~~~~  127 (287)
T KOG0703|consen   92 YYEAK-LPDP------FRRPGPDDLVEQFIRDKYERKKFLDPE  127 (287)
T ss_pred             hcccc-CCcc------ccCCChHHHHHHHHHHHHhhhhhccch
Confidence            99976 3322      1111111 3455788999999999864


No 7  
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=100.00  E-value=1.1e-34  Score=235.88  Aligned_cols=107  Identities=43%  Similarity=0.783  Sum_probs=93.7

Q ss_pred             CCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHHHHhhcCCCCCC
Q 023884           14 PGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNTFLSQYGIPKET   93 (276)
Q Consensus        14 p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~~~e~~~~~~~~   93 (276)
                      |+|++|+||++++|+|||++||||||++|+|+||.||+|||+||||+||+|++++|++|+.+||.++|+||+++..+...
T Consensus         1 ~~N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~lg~his~VkSl~md~w~~~~i~~~~~~GN~~~n~~~e~~~~~~~~   80 (112)
T smart00105        1 PGNKKCFDCGAPNPTWASVNLGVFLCIECSGIHRSLGVHISKVRSLTLDTWTEEELRLLQKGGNENANSIWESNLDDFSL   80 (112)
T ss_pred             CCCCcccCCCCCCCCcEEeccceeEhHHhHHHHHhcCCCcCeeeecccCCCCHHHHHHHHHhhhHHHHHHHHhhCCcccc
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999987654321


Q ss_pred             ChhhhccchHHHHHHHHHHHHHcCCCCCCC
Q 023884           94 DIVTKYNTNAASIYRDRIQAIAEGRPWRDP  123 (276)
Q Consensus        94 ~i~~KY~s~aa~~yr~kl~~~~egr~~~~~  123 (276)
                      ..  . .......|+++|+.+|+.+.|.++
T Consensus        81 ~~--~-~~~~~~~~~~fI~~KY~~k~f~~~  107 (112)
T smart00105       81 KP--P-DSDDQQKYESFIAAKYEEKLFVPP  107 (112)
T ss_pred             CC--C-CCchHHHHHHHHHHHHHhhhcccc
Confidence            11  1 122345788999999999999874


No 8  
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=99.96  E-value=2e-29  Score=248.66  Aligned_cols=115  Identities=23%  Similarity=0.493  Sum_probs=97.3

Q ss_pred             HHHHHHHHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHH
Q 023884            3 ATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNT   82 (276)
Q Consensus         3 a~~~L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~   82 (276)
                      .+++|++|++.|+|++|+||++.+|+|||++||||||++|+||||.||   ++||||+||+|+++||++|+.+||+++|+
T Consensus        10 nekILreLlklPgNk~CADCgs~~P~WASiNlGIFICi~CSGIHRsLG---hRVKSLSLDkWT~EEVe~Mk~gGN~~AN~   86 (648)
T PLN03119         10 NEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT---HRVKSVSMSKFTSKEVEVLQNGGNQRARE   86 (648)
T ss_pred             HHHHHHHHhhCcCCCccccCCCCCCCceeeccceEEeccchhhhccCC---ceeeccccCCCCHHHHHHHHHhchHHHHH
Confidence            467899999999999999999999999999999999999999999998   38999999999999999999999999999


Q ss_pred             HHhhcCCCCCCChhhhccchHHHHHHHHHHHHHcCCCCCCC
Q 023884           83 FLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPWRDP  123 (276)
Q Consensus        83 ~~e~~~~~~~~~i~~KY~s~aa~~yr~kl~~~~egr~~~~~  123 (276)
                      ||+++.......+..   ....+..+++|+.+|+.|.|...
T Consensus        87 iyeanw~~~~~~~P~---~sD~e~lr~FIR~KYVeKRF~~~  124 (648)
T PLN03119         87 IYLKNWDHQRQRLPE---NSNAERVREFIKNVYVQKKYAGA  124 (648)
T ss_pred             HHHhhcccccCCCCC---CccHHHHHHHHHHHHhhhhccCc
Confidence            999754322111111   11224567899999999999853


No 9  
>PLN03131 hypothetical protein; Provisional
Probab=99.96  E-value=2.2e-29  Score=250.12  Aligned_cols=114  Identities=24%  Similarity=0.516  Sum_probs=96.5

Q ss_pred             HHHHHHHHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHH
Q 023884            3 ATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNT   82 (276)
Q Consensus         3 a~~~L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~   82 (276)
                      .+++|++|++.|+|++|+||++++|+|||++||||||++|+||||.|| |  +||||+||+|+++||++|+.+||+++|+
T Consensus        10 nekiLreLlk~PgNk~CADCga~~P~WASiNlGIFICi~CSGIHRsLg-h--RVKSVTLD~WtdeEV~~Mk~gGN~~AN~   86 (705)
T PLN03131         10 NEKIIRGLMKLPPNRRCINCNSLGPQFVCTNFWTFICMTCSGIHREFT-H--RVKSVSMSKFTSQDVEALQNGGNQRARE   86 (705)
T ss_pred             HHHHHHHHhhCcCCCccccCCCCCCCeeEeccceEEchhchhhhcccC-c--ccccccCCCCCHHHHHHHHHhccHHHHH
Confidence            467899999999999999999999999999999999999999999997 3  8999999999999999999999999999


Q ss_pred             HHhhcCCCCCCChhhhccchHHHHHHHHHHHHHcCCCCCC
Q 023884           83 FLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPWRD  122 (276)
Q Consensus        83 ~~e~~~~~~~~~i~~KY~s~aa~~yr~kl~~~~egr~~~~  122 (276)
                      ||+++.......+..   ....+..+++|+.+|+.|+|..
T Consensus        87 iyeanwd~~r~~lP~---~sd~ekrr~FIR~KYVeKRFa~  123 (705)
T PLN03131         87 IYLKDWDQQRQRLPD---NSKVDKIREFIKDIYVDKKYAG  123 (705)
T ss_pred             HHHhhcccccCCCCC---CccHHHHHHHHHHHHhhhhhhc
Confidence            999653222111111   1223456789999999999975


No 10 
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms]
Probab=99.86  E-value=3.6e-22  Score=197.53  Aligned_cols=113  Identities=38%  Similarity=0.689  Sum_probs=92.6

Q ss_pred             HHHHHHHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHHH
Q 023884            4 TRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNTF   83 (276)
Q Consensus         4 ~~~L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~~   83 (276)
                      +-.|+.|+..+||..|+||+.++|.|||+++||.||++|+||||.||.|+|+||+|.||.|..|.+..|..+||+.+|.+
T Consensus       501 a~a~qairn~rgn~~c~dc~~~n~~wAslnlg~l~cieCsgihr~lgt~lSrvr~LeLDdWPvEl~~Vm~aiGN~~AN~v  580 (749)
T KOG0705|consen  501 AMALQAIRNMRGNSHCVDCGTPNPKWASLNLGVLMCIECSGIHRNLGTHLSRVRSLELDDWPVELLKVMSAIGNDLANSV  580 (749)
T ss_pred             HHHHHHHhcCcCCceeeecCCCCcccccccCCeEEEEEchhhhhhhhhhhhhhhccccccCcHHHHHHHHHhhhhHHHHH
Confidence            44688899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Hhh--cCCCCCCChhhhccchHHHHHH-HHHHHHHcCCCCCCC
Q 023884           84 LSQ--YGIPKETDIVTKYNTNAASIYR-DRIQAIAEGRPWRDP  123 (276)
Q Consensus        84 ~e~--~~~~~~~~i~~KY~s~aa~~yr-~kl~~~~egr~~~~~  123 (276)
                      ||.  .|..++.       -+..+.-| .+|.++||.+.|..|
T Consensus       581 WE~~~~G~~KPs-------~~s~REEkErwIr~KYeqklFLaP  616 (749)
T KOG0705|consen  581 WEGSSQGQTKPS-------PDSSREEKERWIRAKYEQKLFLAP  616 (749)
T ss_pred             hhhhccCCcCCC-------ccccHHHHHHHHHHHHHHHhhcCC
Confidence            984  2322221       11111122 256777777766654


No 11 
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms]
Probab=99.80  E-value=1.2e-20  Score=195.54  Aligned_cols=81  Identities=44%  Similarity=0.882  Sum_probs=78.9

Q ss_pred             HHHHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHHHHhh
Q 023884            7 LRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNTFLSQ   86 (276)
Q Consensus         7 L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~~~e~   86 (276)
                      +..+++.|+|.+|+|||++.|.|+|+++||.+|++|+|+||.||||||+||||+||.|..+.+..|+..||..+|.+|++
T Consensus       417 ~~~vq~~pgN~~c~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD~~~~~l~~l~~~lgn~~~N~i~e~  496 (785)
T KOG0521|consen  417 IEEVQSVPGNAQCCDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLDVWEPELLLLFKNLGNKYVNEIYEA  496 (785)
T ss_pred             hhhhhcCCchhhhhhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhhccCcHHHHHHHHhCcchhhhhhhc
Confidence            67889999999999999999999999999999999999999999999999999999999999999999999999999986


Q ss_pred             c
Q 023884           87 Y   87 (276)
Q Consensus        87 ~   87 (276)
                      .
T Consensus       497 ~  497 (785)
T KOG0521|consen  497 L  497 (785)
T ss_pred             c
Confidence            4


No 12 
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms]
Probab=99.68  E-value=1.2e-17  Score=163.60  Aligned_cols=108  Identities=29%  Similarity=0.504  Sum_probs=86.7

Q ss_pred             cCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHHHHhhcCCCC
Q 023884           12 SQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNTFLSQYGIPK   91 (276)
Q Consensus        12 ~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~~~e~~~~~~   91 (276)
                      +...-++|+||++++|.||||+-|||||.+|..+||.||.|||.||+|....|.++.|+++....|..+|.+||.+.++.
T Consensus         4 ~~l~~evC~DC~~~dp~WASvnrGt~lC~eCcsvHrsLGrhIS~vrhLR~s~W~pt~l~~V~tLn~~gaNsIWEh~Lld~   83 (669)
T KOG0818|consen    4 RLLSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLRHTPWPPTLLQMVETLNNNGANSIWEHSLLDP   83 (669)
T ss_pred             cchhhhhhcccCCCCCcceeecCceEehHhhhHHHhhhcchHHHHHHhccCCCCHHHHHHHHHHHhcCcchhhhhhccCc
Confidence            44567899999999999999999999999999999999999999999999999999999999999999999999765542


Q ss_pred             C--------CChhhhccchHHHHHHHHHHHHHcCCCCCCC
Q 023884           92 E--------TDIVTKYNTNAASIYRDRIQAIAEGRPWRDP  123 (276)
Q Consensus        92 ~--------~~i~~KY~s~aa~~yr~kl~~~~egr~~~~~  123 (276)
                      .        ...++|.+...++    +|+++|+-..|+..
T Consensus        84 st~~sg~rk~~pqD~~Hp~K~e----FIkaKy~~LtFv~~  119 (669)
T KOG0818|consen   84 ATIMSGRRKANPQDKVHPNKAE----FIRAKYQMLAFVHR  119 (669)
T ss_pred             hhhhcccCCCCCcCCCCccHHH----HHHHHHHheeeecc
Confidence            1        1234444433333    44455555566653


No 13 
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton]
Probab=99.58  E-value=4.8e-16  Score=159.44  Aligned_cols=94  Identities=36%  Similarity=0.616  Sum_probs=81.6

Q ss_pred             HHhcCCCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCcccceeecccC--CCCHHHHHHHHhcChHHHHHHHhh
Q 023884            9 DLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD--SWSEIQIKKMEAGGNERLNTFLSQ   86 (276)
Q Consensus         9 ~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD--~Ws~~el~~m~~gGN~~~n~~~e~   86 (276)
                      .+=....|+.|+||+++.|.|||+|++|.||-.|+|-||+||..+|+|+|++||  .|+.+-|+++...||.++|+||..
T Consensus       291 riW~ne~nr~cadC~ssrPdwasiNL~vvIck~caGqhrslgs~dSkvrslkmd~svwsneliElfivlgn~~an~Fwa~  370 (1186)
T KOG1117|consen  291 RIWLNEENRECADCGSSRPDWASINLCVVICKPCAGQHRSLGSGDSKVRSLKMDPSVWSNELIELFIVLGNPRANRFWAG  370 (1186)
T ss_pred             HHHhccccccccccCCCCCcccccccceEEcccCCCccccCCCccccccccccCcccccchhhhhheeecCccccccccc
Confidence            344567899999999999999999999999999999999999999999999999  899999999999999999999975


Q ss_pred             cCCCC------------CCChhhhccch
Q 023884           87 YGIPK------------ETDIVTKYNTN  102 (276)
Q Consensus        87 ~~~~~------------~~~i~~KY~s~  102 (276)
                      +-.+.            ..+|++||.+-
T Consensus       371 nl~~~e~lh~dssp~~r~~fi~~Kykeg  398 (1186)
T KOG1117|consen  371 NLPPNEHLHPDSSPSTRRQFIKEKYKEG  398 (1186)
T ss_pred             CCCCccccCCCCCcchhhhHHHHHhhcc
Confidence            43221            13667777654


No 14 
>KOG0702 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=99.40  E-value=3.2e-13  Score=132.50  Aligned_cols=117  Identities=18%  Similarity=0.371  Sum_probs=96.0

Q ss_pred             HHHHHHHhcCCCCCCccCCCCCCC-CceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHH
Q 023884            4 TRRLRDLQSQPGNKICVDCAQKNP-QWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNT   82 (276)
Q Consensus         4 ~~~L~~L~~~p~Nk~C~DCga~~P-~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~   82 (276)
                      +.+||.|+++|+|++|++|....+ .|+.++-|-|+|+.|+|.-|+|-. -.+||||.|..|++.|+..++.+||+.+++
T Consensus        13 ek~iR~l~kLP~NrrC~nCnsl~~~t~~~~~~g~fv~~~~sg~ls~l~~-ahRvksiSmttft~qevs~lQshgNq~~k~   91 (524)
T KOG0702|consen   13 EKEIRRLLKLPENRRCINCNSLVAATYVVYTVGSFVCTMCSGLLSGLNP-AHRVKSISMTTFTDQEVSFLQSHGNQVCKE   91 (524)
T ss_pred             HHHHHHHhcCCCCCceeeccccccceEEEeeccceeeeccchhhccCCC-ccccceeeeeeccccchHHHhhcchhhhhh
Confidence            678999999999999999999887 999999999999999999999843 358999999999999999999999999999


Q ss_pred             HHhhcCCCCCCChhhhccchHHHHHHHHHHHHHcCCCCCCCC
Q 023884           83 FLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPWRDPP  124 (276)
Q Consensus        83 ~~e~~~~~~~~~i~~KY~s~aa~~yr~kl~~~~egr~~~~~p  124 (276)
                      +|-+--......+.   +.+.....|++|+.+|+++.|+.++
T Consensus        92 i~fkl~D~q~S~vP---D~rn~~~~kef~q~~y~~kr~~v~~  130 (524)
T KOG0702|consen   92 IWFKLFDFQRSNVP---DSRNPQKVKEFQQEKYVKKRYYVPK  130 (524)
T ss_pred             hhhcchhhhhccCC---CcccchhhHHHHhhhhccceeecCc
Confidence            88532111111111   1222345788999999999999875


No 15 
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms]
Probab=91.91  E-value=0.042  Score=58.43  Aligned_cols=69  Identities=14%  Similarity=0.289  Sum_probs=56.5

Q ss_pred             cCCCCCCccCCCC-CCCCceEeccccceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcChHHHHH
Q 023884           12 SQPGNKICVDCAQ-KNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNT   82 (276)
Q Consensus        12 ~~p~Nk~C~DCga-~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gGN~~~n~   82 (276)
                      ....+-.|++|.+ ..-.|+++++.+-+|..|+++|+.++.|++.++++.++...+  |.....-|+..++.
T Consensus       626 ~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~s~lh~a~~~~~~~~~e~ll~~ga~--vn~~d~~g~~plh~  695 (785)
T KOG0521|consen  626 KASSDGECLPRIATALAHGCCENWPVVLCIGCSLLHVAVGTGDSGAVELLLQNGAD--VNALDSKGRTPLHH  695 (785)
T ss_pred             HhccCccchhhhhhhhcchhhhccchhhhcccchhhhhhccchHHHHHHHHhcCCc--chhhhccCCCcchh
Confidence            3445778999998 688899999999999999999999999999999999998888  44444445555544


No 16 
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=85.03  E-value=0.61  Score=41.96  Aligned_cols=39  Identities=23%  Similarity=0.389  Sum_probs=30.6

Q ss_pred             HHHHHhcCCCCCCccCCCCCCC-CceEeccccceehhhhh
Q 023884            6 RLRDLQSQPGNKICVDCAQKNP-QWASVSYGVFMCLECSG   44 (276)
Q Consensus         6 ~L~~L~~~p~Nk~C~DCga~~P-~WaS~~~GiFICl~Csg   44 (276)
                      .|..+--.|.-..|+-||.+.. .|.++..|.++|..|..
T Consensus       139 lL~~~G~~p~l~~C~~Cg~~~~~~~f~~~~gg~~c~~c~~  178 (247)
T PRK00085        139 LLAELGYGLDLDHCAVCGAPGDHRYFSPKEGGAVCSECGD  178 (247)
T ss_pred             HHHHcCCccchhhHhcCCCCCCceEEecccCCcccccccC
Confidence            3444445666779999999755 78899999999999973


No 17 
>TIGR00613 reco DNA repair protein RecO. All proteins in this family for which functions are known are DNA binding proteins that are involved in the initiation of recombination or recombinational repair.
Probab=78.28  E-value=1.6  Score=39.02  Aligned_cols=40  Identities=28%  Similarity=0.501  Sum_probs=30.6

Q ss_pred             HHHHHhcCCCCCCccCCCCCCC-CceEeccccceehhhhhh
Q 023884            6 RLRDLQSQPGNKICVDCAQKNP-QWASVSYGVFMCLECSGK   45 (276)
Q Consensus         6 ~L~~L~~~p~Nk~C~DCga~~P-~WaS~~~GiFICl~Csgi   45 (276)
                      .|..+--.|.-..|+.||...+ .+.++..|.|+|.+|...
T Consensus       137 lL~~~G~~p~l~~C~~cg~~~~~~~fs~~~gg~~C~~c~~~  177 (241)
T TIGR00613       137 LLQILGYALDLDKCAVCGSKEDLIYFSMTYGGALCRQCGEK  177 (241)
T ss_pred             HHHHcCCCcccCccCCCCCcCCCceEchhcCeEEChhhCcc
Confidence            3444455667789999998544 688999999999999764


No 18 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=75.36  E-value=2.7  Score=27.68  Aligned_cols=34  Identities=18%  Similarity=0.387  Sum_probs=28.9

Q ss_pred             CCCCccCCCCCCCCceEeccccceehhhhhh-hcc
Q 023884           15 GNKICVDCAQKNPQWASVSYGVFMCLECSGK-HRG   48 (276)
Q Consensus        15 ~Nk~C~DCga~~P~WaS~~~GiFICl~Csgi-HR~   48 (276)
                      .+..|..|......+-..+-.++||..|... |++
T Consensus         2 ~~~~C~~H~~~~~~~~C~~C~~~~C~~C~~~~H~~   36 (42)
T PF00643_consen    2 QEPKCPEHPEEPLSLFCEDCNEPLCSECTVSGHKG   36 (42)
T ss_dssp             SSSB-SSTTTSBEEEEETTTTEEEEHHHHHTSTTT
T ss_pred             cCccCccCCccceEEEecCCCCccCccCCCCCCCC
Confidence            3568999998878899999999999999987 887


No 19 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=73.52  E-value=3.2  Score=32.94  Aligned_cols=41  Identities=22%  Similarity=0.656  Sum_probs=29.6

Q ss_pred             HHHHHHHH-hcCCCCCCccCCCCCCCCceEeccccceehhhhhh
Q 023884            3 ATRRLRDL-QSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGK   45 (276)
Q Consensus         3 a~~~L~~L-~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~Csgi   45 (276)
                      .|+...+| .....-..|-.|+.+  .---+..||+.|..|-..
T Consensus        21 ~Rrrv~~ie~~~~~~~~Cp~C~~~--~VkR~a~GIW~C~kCg~~   62 (89)
T COG1997          21 LRRRVKEIEAQQRAKHVCPFCGRT--TVKRIATGIWKCRKCGAK   62 (89)
T ss_pred             HHHHHHHHHHHHhcCCcCCCCCCc--ceeeeccCeEEcCCCCCe
Confidence            45555555 344456789999998  455778999999999543


No 20 
>PRK12495 hypothetical protein; Provisional
Probab=73.50  E-value=2.5  Score=38.76  Aligned_cols=29  Identities=21%  Similarity=0.399  Sum_probs=23.5

Q ss_pred             CCCCCCccCCCCCCCCceEeccccceehhhhhh
Q 023884           13 QPGNKICVDCAQKNPQWASVSYGVFMCLECSGK   45 (276)
Q Consensus        13 ~p~Nk~C~DCga~~P~WaS~~~GiFICl~Csgi   45 (276)
                      ...+..|-+||.|-|..    -|+.+|..|..+
T Consensus        39 tmsa~hC~~CG~PIpa~----pG~~~Cp~CQ~~   67 (226)
T PRK12495         39 TMTNAHCDECGDPIFRH----DGQEFCPTCQQP   67 (226)
T ss_pred             ccchhhcccccCcccCC----CCeeECCCCCCc
Confidence            34689999999999932    699999999744


No 21 
>COG1381 RecO Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=70.44  E-value=2.5  Score=38.93  Aligned_cols=37  Identities=27%  Similarity=0.579  Sum_probs=29.4

Q ss_pred             HHHHhcCCCCCCccCCCCCCC-CceEeccccceehhhh
Q 023884            7 LRDLQSQPGNKICVDCAQKNP-QWASVSYGVFMCLECS   43 (276)
Q Consensus         7 L~~L~~~p~Nk~C~DCga~~P-~WaS~~~GiFICl~Cs   43 (276)
                      |..+--.+.=..|+.||.+.+ ...|+..|-+||.+|+
T Consensus       145 L~~~G~~~~l~~Ca~cg~~~~~~~~s~~~~~~~C~~~~  182 (251)
T COG1381         145 LGELGIGPNLTSCARCGTPVDPVYFSPKSGGFLCSKCA  182 (251)
T ss_pred             HHHcCCccchHHHhCcCCcCCCcceeeccCcccchhcc
Confidence            333444556678999999755 6999999999999998


No 22 
>PRK11019 hypothetical protein; Provisional
Probab=66.30  E-value=2  Score=34.02  Aligned_cols=37  Identities=19%  Similarity=0.510  Sum_probs=25.5

Q ss_pred             CCCCccCCCCCCC--CceEeccccceehhhhhhhccCCCc
Q 023884           15 GNKICVDCAQKNP--QWASVSYGVFMCLECSGKHRGLGVH   52 (276)
Q Consensus        15 ~Nk~C~DCga~~P--~WaS~~~GiFICl~CsgiHR~LGvh   52 (276)
                      .-..|.|||.+=|  .+.-+. ++-.|++|...+-..+.|
T Consensus        35 syg~C~~CG~~Ip~~Rl~A~P-~a~~Cv~Cq~~~E~~~k~   73 (88)
T PRK11019         35 SLTECEECGEPIPEARRKAIP-GVRLCVACQQEKDLQQAA   73 (88)
T ss_pred             cCCeeCcCCCcCcHHHHhhcC-CccccHHHHHHHHHHHhH
Confidence            4579999999655  333333 678899999876554444


No 23 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=63.45  E-value=4  Score=27.45  Aligned_cols=26  Identities=23%  Similarity=0.543  Sum_probs=20.7

Q ss_pred             CccCCCCCCCCceEeccccceehhhhh
Q 023884           18 ICVDCAQKNPQWASVSYGVFMCLECSG   44 (276)
Q Consensus        18 ~C~DCga~~P~WaS~~~GiFICl~Csg   44 (276)
                      +|-.||+.. .-....-|-+||..|--
T Consensus         2 ~Cp~Cg~~~-~~~D~~~g~~vC~~CG~   27 (43)
T PF08271_consen    2 KCPNCGSKE-IVFDPERGELVCPNCGL   27 (43)
T ss_dssp             SBTTTSSSE-EEEETTTTEEEETTT-B
T ss_pred             CCcCCcCCc-eEEcCCCCeEECCCCCC
Confidence            699999977 45567789999999943


No 24 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=63.36  E-value=4.8  Score=26.30  Aligned_cols=32  Identities=28%  Similarity=0.726  Sum_probs=23.0

Q ss_pred             ccCCCC-CCCCceEeccccc-eehhhhhhhccCC
Q 023884           19 CVDCAQ-KNPQWASVSYGVF-MCLECSGKHRGLG   50 (276)
Q Consensus        19 C~DCga-~~P~WaS~~~GiF-ICl~CsgiHR~LG   50 (276)
                      |..|+. ..|+|=....|-. ||-.|--.+|..+
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk~~   34 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKKYG   34 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHHHS
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHHhC
Confidence            889998 5899998888887 9999987766543


No 25 
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=61.96  E-value=7.6  Score=27.47  Aligned_cols=38  Identities=21%  Similarity=0.531  Sum_probs=30.6

Q ss_pred             CCCCccCCCC-CCCCceEecccc-ceehhhhhhhccCCCc
Q 023884           15 GNKICVDCAQ-KNPQWASVSYGV-FMCLECSGKHRGLGVH   52 (276)
Q Consensus        15 ~Nk~C~DCga-~~P~WaS~~~Gi-FICl~CsgiHR~LGvh   52 (276)
                      ....|..|+. ..|+|=.-..|. +||-.|.-..+..+..
T Consensus         2 ~~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~~   41 (52)
T smart00401        2 SGRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGGL   41 (52)
T ss_pred             CCCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCCC
Confidence            3578999999 689998888886 9999998777765543


No 26 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=59.10  E-value=5.5  Score=27.77  Aligned_cols=26  Identities=27%  Similarity=0.836  Sum_probs=20.0

Q ss_pred             CccCCCCCCCCceEeccccceehhhhh
Q 023884           18 ICVDCAQKNPQWASVSYGVFMCLECSG   44 (276)
Q Consensus        18 ~C~DCga~~P~WaS~~~GiFICl~Csg   44 (276)
                      +|+=|+.+.+. -=.=+|-|||.+|-.
T Consensus         1 ~CiiC~~~~~~-GI~I~~~fIC~~CE~   26 (46)
T PF10764_consen    1 KCIICGKEKEE-GIHIYGKFICSDCEK   26 (46)
T ss_pred             CeEeCCCcCCC-CEEEECeEehHHHHH
Confidence            48889987776 344589999999954


No 27 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=55.51  E-value=4.4  Score=26.69  Aligned_cols=27  Identities=15%  Similarity=0.533  Sum_probs=16.3

Q ss_pred             CCccCCCCC-CCCceEeccccceehhhh
Q 023884           17 KICVDCAQK-NPQWASVSYGVFMCLECS   43 (276)
Q Consensus        17 k~C~DCga~-~P~WaS~~~GiFICl~Cs   43 (276)
                      ..|.+|+.+ .-.|..-+|+.-||..|.
T Consensus         4 ~~C~eC~~~f~dSyL~~~F~~~VCD~CR   31 (34)
T PF01286_consen    4 PKCDECGKPFMDSYLLNNFDLPVCDKCR   31 (34)
T ss_dssp             EE-TTT--EES-SSCCCCTS-S--TTT-
T ss_pred             chHhHhCCHHHHHHHHHhCCcccccccc
Confidence            479999994 667999999999999994


No 28 
>TIGR02419 C4_traR_proteo phage/conjugal plasmid C-4 type zinc finger protein, TraR family. Members of this family are putative C4-type zinc finger proteins found almost exclusively in prophage regions, actual phage, or conjugal transfer regions of the Proteobactia. This small protein (about 70 amino acids) appears homologous to but is smaller than DksA (DnaK suppressor protein), found to be critical for regulating transcription of ribosomal RNA.
Probab=54.83  E-value=5.3  Score=29.46  Aligned_cols=35  Identities=26%  Similarity=0.510  Sum_probs=23.2

Q ss_pred             cCCCCCCccCCCCCCCCce-Eeccccceehhhhhhh
Q 023884           12 SQPGNKICVDCAQKNPQWA-SVSYGVFMCLECSGKH   46 (276)
Q Consensus        12 ~~p~Nk~C~DCga~~P~Wa-S~~~GiFICl~CsgiH   46 (276)
                      ..++...|.|||.+=|.=- -.--++..|..|...|
T Consensus        27 ~~~s~g~C~~Cg~~Ip~~Rl~a~p~~~~Cv~Cq~~~   62 (63)
T TIGR02419        27 IGPSLRECEDCGEPIPEARREALPGVTRCVSCQEIL   62 (63)
T ss_pred             cCCCCCeeccCCCcChHHHHhhcCCcCCcHHHHhhc
Confidence            3456779999999655211 1223678899998654


No 29 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=54.17  E-value=9.3  Score=25.22  Aligned_cols=27  Identities=26%  Similarity=0.728  Sum_probs=22.8

Q ss_pred             CCCCCccCCCCCCCCceEeccccceehhhh
Q 023884           14 PGNKICVDCAQKNPQWASVSYGVFMCLECS   43 (276)
Q Consensus        14 p~Nk~C~DCga~~P~WaS~~~GiFICl~Cs   43 (276)
                      ..|..|..|++.   |....=|-++|..|-
T Consensus         6 ~~~~~C~~C~~~---~~~~~dG~~yC~~cG   32 (36)
T PF11781_consen    6 GPNEPCPVCGSR---WFYSDDGFYYCDRCG   32 (36)
T ss_pred             cCCCcCCCCCCe---EeEccCCEEEhhhCc
Confidence            346679999998   888899999999983


No 30 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=50.96  E-value=15  Score=29.26  Aligned_cols=39  Identities=21%  Similarity=0.572  Sum_probs=29.1

Q ss_pred             HHHHHHHH-hcCCCCCCccCCCCCCCCceEeccccceehhhh
Q 023884            3 ATRRLRDL-QSQPGNKICVDCAQKNPQWASVSYGVFMCLECS   43 (276)
Q Consensus         3 a~~~L~~L-~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~Cs   43 (276)
                      .|+.+.+| .....--.|.-|+........+  ||+-|..|.
T Consensus        22 lRK~v~kie~~q~a~y~CpfCgk~~vkR~a~--GIW~C~~C~   61 (90)
T PTZ00255         22 LRKQIKKIEISQHAKYFCPFCGKHAVKRQAV--GIWRCKGCK   61 (90)
T ss_pred             HHHHHHHHHHHHhCCccCCCCCCCceeeeee--EEEEcCCCC
Confidence            45666665 4555677999999877766554  999999994


No 31 
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER  has  a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserv
Probab=50.54  E-value=11  Score=29.18  Aligned_cols=31  Identities=23%  Similarity=0.643  Sum_probs=25.7

Q ss_pred             CCCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           15 GNKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        15 ~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      .|..|.-|+.+.-   ...||++.|..|.+..|-
T Consensus         2 ~~~~C~VCg~~~~---g~hyGv~sC~aC~~FFRR   32 (82)
T cd07171           2 DTHFCAVCSDYAS---GYHYGVWSCEGCKAFFKR   32 (82)
T ss_pred             CCCCCeecCCcCc---ceEECceeehhhHHhHHH
Confidence            4678999997554   579999999999998864


No 32 
>PRK13715 conjugal transfer protein TraR; Provisional
Probab=46.02  E-value=8.6  Score=29.25  Aligned_cols=33  Identities=24%  Similarity=0.583  Sum_probs=22.2

Q ss_pred             CCCccCCCCCCCCc-eEeccccceehhhhhhhcc
Q 023884           16 NKICVDCAQKNPQW-ASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        16 Nk~C~DCga~~P~W-aS~~~GiFICl~CsgiHR~   48 (276)
                      ...|.|||.+=|.= .-.--|+..|++|...+-.
T Consensus        34 ~~~C~~Cg~~Ip~~Rl~a~p~~~~Cv~Cq~~~E~   67 (73)
T PRK13715         34 VYLCEACGNPIPEARRKIFPGVTLCVECQAYQER   67 (73)
T ss_pred             cccHhhcCCcCCHHHHhcCCCcCCCHHHHHHHHH
Confidence            45899999975521 1122378899999876543


No 33 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=45.15  E-value=3.5  Score=26.75  Aligned_cols=29  Identities=31%  Similarity=0.787  Sum_probs=16.4

Q ss_pred             CccCCCCCCCC-ceEeccccceehhhhhhh
Q 023884           18 ICVDCAQKNPQ-WASVSYGVFMCLECSGKH   46 (276)
Q Consensus        18 ~C~DCga~~P~-WaS~~~GiFICl~CsgiH   46 (276)
                      .|.+||.+=|. =.-+--+..+|..|+..|
T Consensus         5 ~C~~CGe~I~~~Rl~~~p~~~~C~~C~~~~   34 (36)
T PF01258_consen    5 ICEDCGEPIPEERLVAVPGATLCVECQERR   34 (36)
T ss_dssp             B-TTTSSBEEHHHHHHCTTECS-HHHHHHH
T ss_pred             CccccCChHHHHHHHhCCCcEECHHHhCcc
Confidence            49999985321 111223678899998765


No 34 
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=44.23  E-value=15  Score=29.23  Aligned_cols=31  Identities=32%  Similarity=0.684  Sum_probs=25.6

Q ss_pred             CCCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           15 GNKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        15 ~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      .+..|.-||.+.-   ...||++.|..|.+..|-
T Consensus         4 ~~~~C~VCg~~~~---g~hyGv~sC~aC~~FFRR   34 (95)
T cd06968           4 EVIPCKICGDKSS---GIHYGVITCEGCKGFFRR   34 (95)
T ss_pred             cccCCcccCCcCc---ceEECceeehhhHHhhHH
Confidence            4668999998664   458999999999998873


No 35 
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family.  Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription 
Probab=43.78  E-value=14  Score=29.56  Aligned_cols=30  Identities=23%  Similarity=0.666  Sum_probs=24.6

Q ss_pred             CCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           16 NKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        16 Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      +..|.-|+.+.-   ...||++.|..|.+..|-
T Consensus         4 ~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   33 (97)
T cd07170           4 KRLCLVCGDIAS---GYHYGVASCEACKAFFKR   33 (97)
T ss_pred             CCCCeecCCcCc---ceEECceeehhhhHHHHH
Confidence            357999998664   458999999999998874


No 36 
>PTZ00218 40S ribosomal protein S29; Provisional
Probab=42.81  E-value=10  Score=27.49  Aligned_cols=39  Identities=26%  Similarity=0.571  Sum_probs=27.9

Q ss_pred             CCCCCccCCCCCCCCceEeccccceehhhhhhhccCCCccccee
Q 023884           14 PGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR   57 (276)
Q Consensus        14 p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~Vr   57 (276)
                      ++-+.|.-||.+.  =+--.||+.||..|-   |.+-..|.|||
T Consensus        14 kGsr~C~vCg~~~--gliRkygL~~CRqCF---Re~A~~iGF~K   52 (54)
T PTZ00218         14 KGSRQCRVCSNRH--GLIRKYGLNVCRQCF---RENAELIGFHK   52 (54)
T ss_pred             CCCCeeecCCCcc--hhhhhcCcchhhHHH---HHhhHhcCeee
Confidence            4678999999854  234489999999995   34445566655


No 37 
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics]
Probab=42.16  E-value=22  Score=35.76  Aligned_cols=63  Identities=24%  Similarity=0.400  Sum_probs=32.0

Q ss_pred             cCCCCCCccC-CCC--CCCCceEeccc--cceehhhhhhhccCCCcc-----cceeecc----cCCCCH-HHHHHHHh
Q 023884           12 SQPGNKICVD-CAQ--KNPQWASVSYG--VFMCLECSGKHRGLGVHI-----SFVRSVT----MDSWSE-IQIKKMEA   74 (276)
Q Consensus        12 ~~p~Nk~C~D-Cga--~~P~WaS~~~G--iFICl~CsgiHR~LGvhi-----S~VrSvt----mD~Ws~-~el~~m~~   74 (276)
                      ..++++.||| |..  ..+..+...-.  .+||+.|-.+--.+|+|-     -.|...+    --.|+. |||++++.
T Consensus         9 ~~~g~ky~C~~C~~dit~~i~ikCaeCp~fdLCl~CFs~GaE~~~H~~~H~Yrim~~~s~~i~~~~WtadEEilLLea   86 (438)
T KOG0457|consen    9 DDPGGKYNCDYCSLDITGLIRIKCAECPDFDLCLQCFSVGAETGKHQNDHPYRIMDTNSFPILDPSWTADEEILLLEA   86 (438)
T ss_pred             hcCCCCCCCccHhHHhccceEEEeecCCCcchhHHHHhcccccCCCCCCCCceeecCCCCCCCCCCCChHHHHHHHHH
Confidence            3455555444 655  23332222111  479999986444444442     2233322    137886 67777764


No 38 
>PHA00080 DksA-like zinc finger domain containing protein
Probab=41.01  E-value=15  Score=27.85  Aligned_cols=34  Identities=24%  Similarity=0.620  Sum_probs=22.5

Q ss_pred             CCCCCCccCCCCCCC--CceEeccccceehhhhhhhc
Q 023884           13 QPGNKICVDCAQKNP--QWASVSYGVFMCLECSGKHR   47 (276)
Q Consensus        13 ~p~Nk~C~DCga~~P--~WaS~~~GiFICl~CsgiHR   47 (276)
                      ......|.|||.+=|  .+.-+. ++..|++|...+-
T Consensus        28 ~~~~~~C~~Cg~~Ip~~Rl~a~P-~~~~Cv~Cq~~~E   63 (72)
T PHA00080         28 APSATHCEECGDPIPEARREAVP-GCRTCVSCQEILE   63 (72)
T ss_pred             CCCCCEecCCCCcCcHHHHHhCC-CccCcHHHHHHHH
Confidence            344568999999543  333333 5667999988654


No 39 
>COG1734 DksA DnaK suppressor protein [Signal transduction mechanisms]
Probab=40.87  E-value=9.4  Score=31.82  Aligned_cols=30  Identities=23%  Similarity=0.665  Sum_probs=20.0

Q ss_pred             CccCCCCCCCC-ceEeccccceehhhhhhhc
Q 023884           18 ICVDCAQKNPQ-WASVSYGVFMCLECSGKHR   47 (276)
Q Consensus        18 ~C~DCga~~P~-WaS~~~GiFICl~CsgiHR   47 (276)
                      +|.+||.+=|. =.-.--+..+|++|.-.|-
T Consensus        82 ~Ce~cG~~Ip~~RL~A~P~A~~Ci~cQ~~~E  112 (120)
T COG1734          82 ICEECGEPIPEARLEARPTARLCIECQERAE  112 (120)
T ss_pred             chhccCCcCCHHHHhhCcchHHHHHHHHHHH
Confidence            89999996441 1122235788999987663


No 40 
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=40.80  E-value=18  Score=27.98  Aligned_cols=31  Identities=23%  Similarity=0.596  Sum_probs=25.4

Q ss_pred             CCCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           15 GNKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        15 ~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      ..+.|.-|+.+.-   ...||++-|..|.+..|-
T Consensus         2 ~~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   32 (82)
T cd07173           2 PQKTCLICGDEAS---GCHYGALTCGSCKVFFKR   32 (82)
T ss_pred             CCCCCeecCCcCc---ceEECcchhhhHHHHHHH
Confidence            4567999998654   568999999999998874


No 41 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=40.75  E-value=15  Score=26.66  Aligned_cols=27  Identities=30%  Similarity=0.710  Sum_probs=22.7

Q ss_pred             CCCCccCCCCCCCCceEeccccceehhhh
Q 023884           15 GNKICVDCAQKNPQWASVSYGVFMCLECS   43 (276)
Q Consensus        15 ~Nk~C~DCga~~P~WaS~~~GiFICl~Cs   43 (276)
                      --+.|..||.....  ..+--+|.|..|-
T Consensus        27 TSq~C~~CG~~~~~--~~~~r~~~C~~Cg   53 (69)
T PF07282_consen   27 TSQTCPRCGHRNKK--RRSGRVFTCPNCG   53 (69)
T ss_pred             CccCccCccccccc--ccccceEEcCCCC
Confidence            45789999998887  7788899999984


No 42 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=40.70  E-value=30  Score=23.50  Aligned_cols=39  Identities=15%  Similarity=0.456  Sum_probs=26.3

Q ss_pred             HHHHHHHHhcCCCCCCccCCCCCCCCceEeccccceehhhh
Q 023884            3 ATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECS   43 (276)
Q Consensus         3 a~~~L~~L~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~Cs   43 (276)
                      +++.|.+|+=. ..-+|.-||....-+.. +.+.|-|-.|.
T Consensus         6 c~~~l~~~RW~-~g~~CP~Cg~~~~~~~~-~~~~~~C~~C~   44 (46)
T PF12760_consen    6 CREYLEEIRWP-DGFVCPHCGSTKHYRLK-TRGRYRCKACR   44 (46)
T ss_pred             HHHHHHHhcCC-CCCCCCCCCCeeeEEeC-CCCeEECCCCC
Confidence            55566666544 44779999998554433 26889998884


No 43 
>COG2158 Uncharacterized protein containing a Zn-finger-like domain [General function prediction only]
Probab=40.28  E-value=11  Score=31.10  Aligned_cols=25  Identities=40%  Similarity=0.781  Sum_probs=21.8

Q ss_pred             CceEeccc--cceehhhhhhhccCCCc
Q 023884           28 QWASVSYG--VFMCLECSGKHRGLGVH   52 (276)
Q Consensus        28 ~WaS~~~G--iFICl~CsgiHR~LGvh   52 (276)
                      .|++-.-|  |+-|.+|--|||.-++.
T Consensus        52 ewi~~~~G~~VwSC~dC~~iH~ke~~~   78 (112)
T COG2158          52 EWISDSNGRKVWSCSDCHWIHRKEGAE   78 (112)
T ss_pred             ceeEcCCCCEEeeccccceecccchHH
Confidence            89999989  99999999999975543


No 44 
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=39.85  E-value=20  Score=28.84  Aligned_cols=31  Identities=35%  Similarity=0.832  Sum_probs=25.7

Q ss_pred             CCCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           15 GNKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        15 ~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      .+..|.-|+.+.-   ...||+..|..|.+..|-
T Consensus        17 ~~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   47 (101)
T cd07160          17 GNEVCSVCGDKAS---GFHYNVLSCEGCKGFFRR   47 (101)
T ss_pred             CCCCCeecCCcCc---ceEECcceehhhhhhhhh
Confidence            4678999998654   569999999999998874


No 45 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=38.89  E-value=21  Score=28.06  Aligned_cols=32  Identities=22%  Similarity=0.736  Sum_probs=26.2

Q ss_pred             CCCCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           14 PGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        14 p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      ..++.|.-|+.+.-   ...||+..|..|....|-
T Consensus         4 ~~~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   35 (90)
T cd07169           4 AEQRTCLICGDRAT---GLHYGIISCEGCKGFFKR   35 (90)
T ss_pred             ccCCCCeecCCcCc---ceEECcceehhhHHHHHH
Confidence            45778999998653   568999999999998864


No 46 
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=38.49  E-value=15  Score=29.03  Aligned_cols=29  Identities=28%  Similarity=0.615  Sum_probs=23.4

Q ss_pred             CCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           17 KICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        17 k~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      +.|.-|+.+.-   ...||++.|..|.+..|-
T Consensus         1 ~~C~VCg~~a~---g~hyGv~sC~aC~~FFRR   29 (94)
T cd06966           1 KICGVCGDKAL---GYNFNAITCESCKAFFRR   29 (94)
T ss_pred             CCCeeCCCcCc---ceEECcceeeeehheehh
Confidence            46888987544   458999999999998874


No 47 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=38.16  E-value=17  Score=28.98  Aligned_cols=39  Identities=23%  Similarity=0.587  Sum_probs=28.1

Q ss_pred             HHHHHHHH-hcCCCCCCccCCCCCCCCceEeccccceehhhh
Q 023884            3 ATRRLRDL-QSQPGNKICVDCAQKNPQWASVSYGVFMCLECS   43 (276)
Q Consensus         3 a~~~L~~L-~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~Cs   43 (276)
                      .|+.+.+| ......-.|.-||....  --+..|||-|..|-
T Consensus        21 lRK~vkkie~~q~~ky~Cp~Cgk~~v--kR~a~GIW~C~~C~   60 (90)
T PF01780_consen   21 LRKRVKKIEISQHAKYTCPFCGKTSV--KRVATGIWKCKKCG   60 (90)
T ss_dssp             HHHHHHHHHHHHHS-BEESSSSSSEE--EEEETTEEEETTTT
T ss_pred             HHHHHHHHHHHHhCCCcCCCCCCcee--EEeeeEEeecCCCC
Confidence            35555555 44556789999999874  45678999999995


No 48 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=37.25  E-value=13  Score=24.39  Aligned_cols=30  Identities=20%  Similarity=0.397  Sum_probs=15.2

Q ss_pred             CCccCCCCCCCCceEe---ccccceehhhhhhhc
Q 023884           17 KICVDCAQKNPQWASV---SYGVFMCLECSGKHR   47 (276)
Q Consensus        17 k~C~DCga~~P~WaS~---~~GiFICl~CsgiHR   47 (276)
                      |.|-.||.+- ++..+   +.--++|..|.-||-
T Consensus         1 kfC~~CG~~l-~~~ip~gd~r~R~vC~~Cg~IhY   33 (34)
T PF14803_consen    1 KFCPQCGGPL-ERRIPEGDDRERLVCPACGFIHY   33 (34)
T ss_dssp             -B-TTT--B--EEE--TT-SS-EEEETTTTEEE-
T ss_pred             CccccccChh-hhhcCCCCCccceECCCCCCEEe
Confidence            5788899862 23322   344578999988883


No 49 
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only]
Probab=35.84  E-value=16  Score=31.67  Aligned_cols=34  Identities=26%  Similarity=0.654  Sum_probs=26.4

Q ss_pred             CCCCCccCCCCCCCCceEeccccceeh-hhhhhhcc
Q 023884           14 PGNKICVDCAQKNPQWASVSYGVFMCL-ECSGKHRG   48 (276)
Q Consensus        14 p~Nk~C~DCga~~P~WaS~~~GiFICl-~CsgiHR~   48 (276)
                      |--+.|+-||- ...|.+++.|.-+|. .|-.+|..
T Consensus       116 P~r~fCaVCG~-~S~ysC~~CG~kyCsv~C~~~Hne  150 (156)
T KOG3362|consen  116 PLRKFCAVCGY-DSKYSCVNCGTKYCSVRCLKTHNE  150 (156)
T ss_pred             CcchhhhhcCC-CchhHHHhcCCceeechhhhhccc
Confidence            45678999994 444899999999885 67777754


No 50 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=35.44  E-value=23  Score=33.54  Aligned_cols=33  Identities=15%  Similarity=0.440  Sum_probs=23.5

Q ss_pred             CCCCCCccCCCCCCCCceEeccccceehhhhhhh
Q 023884           13 QPGNKICVDCAQKNPQWASVSYGVFMCLECSGKH   46 (276)
Q Consensus        13 ~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiH   46 (276)
                      .....+|.+||..+. =....-|-.||.+|--|.
T Consensus         8 ~~~~~~Cp~Cg~~~i-v~d~~~Ge~vC~~CG~Vl   40 (310)
T PRK00423          8 EEEKLVCPECGSDKL-IYDYERGEIVCADCGLVI   40 (310)
T ss_pred             cccCCcCcCCCCCCe-eEECCCCeEeecccCCcc
Confidence            345568999997432 234578999999997643


No 51 
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=34.63  E-value=19  Score=26.76  Aligned_cols=22  Identities=45%  Similarity=0.854  Sum_probs=14.4

Q ss_pred             CccCCCCCCCCceEeccccceehhh
Q 023884           18 ICVDCAQKNPQWASVSYGVFMCLEC   42 (276)
Q Consensus        18 ~C~DCga~~P~WaS~~~GiFICl~C   42 (276)
                      +|.|||+.|.-   -.--++-|-+|
T Consensus        22 iCgdC~~en~l---k~~D~irCReC   43 (62)
T KOG3507|consen   22 ICGDCGQENTL---KRGDVIRCREC   43 (62)
T ss_pred             Eeccccccccc---cCCCcEehhhc
Confidence            68888887642   12336778888


No 52 
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=33.96  E-value=26  Score=24.97  Aligned_cols=34  Identities=26%  Similarity=0.647  Sum_probs=27.3

Q ss_pred             CccCCCC-CCCCceEec-cccceehhhhhhhccCCC
Q 023884           18 ICVDCAQ-KNPQWASVS-YGVFMCLECSGKHRGLGV   51 (276)
Q Consensus        18 ~C~DCga-~~P~WaS~~-~GiFICl~CsgiHR~LGv   51 (276)
                      +|..|+. .-|+|=... -+..||-.|--..+..|.
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~   36 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGV   36 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCC
Confidence            5999998 678898765 788999999877776653


No 53 
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=32.66  E-value=23  Score=35.34  Aligned_cols=30  Identities=23%  Similarity=0.562  Sum_probs=21.5

Q ss_pred             CCCCccCCCCCCCCceEecc--ccceehhhhh
Q 023884           15 GNKICVDCAQKNPQWASVSY--GVFMCLECSG   44 (276)
Q Consensus        15 ~Nk~C~DCga~~P~WaS~~~--GiFICl~Csg   44 (276)
                      ++..|--||.+..+--.+-.  ++|||.+|..
T Consensus         6 ~~~~c~fc~~~~~~~~~~~~~~~~~ic~~c~~   37 (413)
T TIGR00382         6 ETLYCSFCGKSQDEVRKLIAGPGVYICDECIE   37 (413)
T ss_pred             CCeecCCCCCChhhcccccCCCCCcCCCchHH
Confidence            34589999997665444433  4899999975


No 54 
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers. DNA-binding domain of Ecdysone receptor (EcR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with highly degenerate pseudo-palindromic response elements, resembling inverted repeats of 5'-AGGTCA-3' separated by 1 bp, upstream of the target gene and modulates the rate of transcriptional initiation. EcR is present only in invertebrates and regulates the expression of a large number of genes during development and reproduction. EcR functions as a heterodimer by partnering with ultraspiracle protein (USP), the ortholog of the vertebrate retinoid X receptor (RXR). The natural ligands of EcR are ecdysteroids, the endogenous steroidal hormones found in invertebrates. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcRs h
Probab=32.21  E-value=29  Score=27.29  Aligned_cols=29  Identities=24%  Similarity=0.750  Sum_probs=23.3

Q ss_pred             CCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           17 KICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        17 k~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      ..|.-|+.+.-   ...||++.|..|.+..|-
T Consensus         2 ~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   30 (91)
T cd07161           2 ELCLVCGDRAS---GYHYNALTCEGCKGFFRR   30 (91)
T ss_pred             CCCeeCCCcCc---ceEECceeehhhHHHHHH
Confidence            35888997655   458999999999998863


No 55 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=31.88  E-value=31  Score=26.79  Aligned_cols=28  Identities=25%  Similarity=0.675  Sum_probs=22.4

Q ss_pred             CccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           18 ICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        18 ~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      +|.-|+.+.-.   ..||++.|..|++..|-
T Consensus         1 ~C~VCg~~~~g---~hygv~sC~aC~~FFRR   28 (87)
T cd07162           1 ICRVCGDRATG---YHFNAMTCEGCKGFFRR   28 (87)
T ss_pred             CCcccCCcCcc---eEECcceehhhHHHHHh
Confidence            47788876553   58999999999998764


No 56 
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer.  RXRs can play different roles in these heterodimers. RXR  acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear rec
Probab=31.64  E-value=33  Score=26.01  Aligned_cols=28  Identities=32%  Similarity=0.856  Sum_probs=22.9

Q ss_pred             CccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           18 ICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        18 ~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      .|.-|+.+.-   ...||++.|..|.+..|-
T Consensus         2 ~C~VC~~~~~---g~hygv~sC~aC~~FFRR   29 (77)
T cd06956           2 ICAICGDRAS---GKHYGVYSCEGCKGFFKR   29 (77)
T ss_pred             CCcccCCcCc---ceEECceeehhHHHHHHH
Confidence            5888887654   468999999999998863


No 57 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=30.99  E-value=38  Score=22.85  Aligned_cols=22  Identities=23%  Similarity=0.646  Sum_probs=13.8

Q ss_pred             CccCCCCCCCCceEecccccee
Q 023884           18 ICVDCAQKNPQWASVSYGVFMC   39 (276)
Q Consensus        18 ~C~DCga~~P~WaS~~~GiFIC   39 (276)
                      +|.+|+..+.-|+++.-+-..|
T Consensus         1 ~C~~C~~~~~l~~CL~C~~~~c   22 (50)
T smart00290        1 RCSVCGTIENLWLCLTCGQVGC   22 (50)
T ss_pred             CcccCCCcCCeEEecCCCCccc
Confidence            5999998776555444443333


No 58 
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers. DNA-binding domain of REV-ERB receptor- like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. REV-ERB receptors are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. REV-ERB receptors bind as a monomer to a (A/G)GGTCA half-site with a 5' AT-rich extension or as a homodimer to a direct repeat 2 element (AGGTCA sequence with a 2-bp spacer), indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target genes. The porphyr
Probab=30.95  E-value=25  Score=27.52  Aligned_cols=30  Identities=33%  Similarity=0.730  Sum_probs=24.3

Q ss_pred             CCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           16 NKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        16 Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      +..|.-||.+.-   ...||++.|..|....|-
T Consensus         3 ~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   32 (89)
T cd07166           3 VVLCKVCGDKAS---GFHYGVHACEGCKGFFRR   32 (89)
T ss_pred             CCCCcccCccCc---ceEEChhhhhhHhhEecc
Confidence            456999998665   457999999999998774


No 59 
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TLX interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX has a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=30.82  E-value=23  Score=27.88  Aligned_cols=30  Identities=27%  Similarity=0.744  Sum_probs=24.9

Q ss_pred             CCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           16 NKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        16 Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      +..|.-|+.+.-   ...||+..|..|++..|-
T Consensus         6 ~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   35 (92)
T cd07163           6 DIPCKVCGDRSS---GKHYGIYACDGCSGFFKR   35 (92)
T ss_pred             CCCCcccCCcCc---ccEECceeeeeeeeEEee
Confidence            678999998654   469999999999998764


No 60 
>TIGR02890 spore_yteA sporulation protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to PFAM family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. The function of proteins in this family is unknown. YteA was detected in mature spores of Bacillus subtilis by Kuwana, et al., and appears to be expressed under control of sigma-K.
Probab=30.52  E-value=23  Score=30.73  Aligned_cols=41  Identities=20%  Similarity=0.528  Sum_probs=24.0

Q ss_pred             HHHHHhcCCCCCCccCCCCCCC--CceEeccccceehhhhhhhcc
Q 023884            6 RLRDLQSQPGNKICVDCAQKNP--QWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus         6 ~L~~L~~~p~Nk~C~DCga~~P--~WaS~~~GiFICl~CsgiHR~   48 (276)
                      +|..|. ...=-+|.+||.+=|  ..--+. .+-.|+.|...+-.
T Consensus        77 AL~Ri~-~G~YG~Ce~CGe~I~~~RL~a~P-~a~~Ci~Cq~~~E~  119 (159)
T TIGR02890        77 ALQKIE-NGTYGICEVCGKPIPYERLEAIP-TATTCVECQNRKEV  119 (159)
T ss_pred             HHHHHh-CCCCCeecccCCcccHHHHhhCC-CcchhHHHHHHhhh
Confidence            344442 234458999999522  222222 35679999987643


No 61 
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers. DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate  a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, p
Probab=30.23  E-value=33  Score=26.15  Aligned_cols=29  Identities=31%  Similarity=0.755  Sum_probs=23.6

Q ss_pred             CCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           17 KICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        17 k~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      +.|.-|+.+.-   ...||++-|..|.+..|-
T Consensus         3 ~~C~VCg~~a~---g~hyGv~sC~aC~~FFRR   31 (78)
T cd07172           3 KICLVCSDEAS---GCHYGVLTCGSCKVFFKR   31 (78)
T ss_pred             CCCeecCCcCc---ceEECceeehhhHHhHHH
Confidence            56888997654   469999999999998863


No 62 
>PF10281 Ish1:  Putative stress-responsive nuclear envelope protein;  InterPro: IPR018803  This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []. 
Probab=29.96  E-value=65  Score=20.98  Aligned_cols=21  Identities=38%  Similarity=0.830  Sum_probs=14.8

Q ss_pred             CCCCHHHHHHHHhcChHHHHHHHhhcCCCCCC
Q 023884           62 DSWSEIQIKKMEAGGNERLNTFLSQYGIPKET   93 (276)
Q Consensus        62 D~Ws~~el~~m~~gGN~~~n~~~e~~~~~~~~   93 (276)
                      |+|++++|+.           ||+.|++..+.
T Consensus         2 dtWs~~~L~~-----------wL~~~gi~~~~   22 (38)
T PF10281_consen    2 DTWSDSDLKS-----------WLKSHGIPVPK   22 (38)
T ss_pred             CCCCHHHHHH-----------HHHHcCCCCCC
Confidence            6788877654           78888876543


No 63 
>COG2174 RPL34A Ribosomal protein L34E [Translation, ribosomal structure and biogenesis]
Probab=29.68  E-value=37  Score=27.22  Aligned_cols=34  Identities=21%  Similarity=0.636  Sum_probs=23.6

Q ss_pred             hcCCCCCCccCCCCCC--------CCc---------eEeccccceehhhhh
Q 023884           11 QSQPGNKICVDCAQKN--------PQW---------ASVSYGVFMCLECSG   44 (276)
Q Consensus        11 ~~~p~Nk~C~DCga~~--------P~W---------aS~~~GiFICl~Csg   44 (276)
                      ++.++--+|+|||.+-        .+.         .+=.||-.+|..|..
T Consensus        29 kK~~~~p~C~~cg~pL~Gi~r~RP~e~~r~skt~krp~RpYGG~lc~~c~~   79 (93)
T COG2174          29 KKKPTIPKCAICGRPLGGIPRGRPREFRRLSKTKKRPERPYGGYLCANCVR   79 (93)
T ss_pred             eccCCCCcccccCCccCCccCCCcHHHHhccccccCcCCCcCceecHHHHH
Confidence            4566777999999851        111         134599999999964


No 64 
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=29.49  E-value=35  Score=25.46  Aligned_cols=27  Identities=22%  Similarity=0.635  Sum_probs=20.8

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-|+.+.-.   ..||++.|..|.+..|-
T Consensus         1 C~VC~~~~~g---~hygv~sC~aC~~FFRR   27 (72)
T cd07156           1 CGVCGDRATG---YHFNAMTCEGCKGFFRR   27 (72)
T ss_pred             CCccCccCcc---cEECcceehhhhhhhch
Confidence            5567765543   48999999999998774


No 65 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=29.34  E-value=20  Score=25.35  Aligned_cols=43  Identities=21%  Similarity=0.557  Sum_probs=25.5

Q ss_pred             CccCCCCCCCCce--EeccccceehhhhhhhccCCCcccceeeccc
Q 023884           18 ICVDCAQKNPQWA--SVSYGVFMCLECSGKHRGLGVHISFVRSVTM   61 (276)
Q Consensus        18 ~C~DCga~~P~Wa--S~~~GiFICl~CsgiHR~LGvhiS~VrSvtm   61 (276)
                      .|+=||..-.-.-  -+.=| +||-.|...-..+-..+..++++|+
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl~~~~~~~~~~~~~t~   45 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKLSGFFSDVKIKKNLTL   45 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHhcCcccchhhhhhccH
Confidence            4788888654443  34556 8999999765444333333444544


No 66 
>PRK10778 dksA RNA polymerase-binding transcription factor; Provisional
Probab=29.13  E-value=35  Score=29.40  Aligned_cols=38  Identities=11%  Similarity=0.187  Sum_probs=23.6

Q ss_pred             cCCCCCCccCCCCCCCC-ceEeccccceehhhhhhhccC
Q 023884           12 SQPGNKICVDCAQKNPQ-WASVSYGVFMCLECSGKHRGL   49 (276)
Q Consensus        12 ~~p~Nk~C~DCga~~P~-WaS~~~GiFICl~CsgiHR~L   49 (276)
                      ..+.--+|-+||.+=|. =.-+--++..|+.|...|-..
T Consensus       107 ~~gtYG~Ce~CGe~I~~~RL~A~P~A~~CI~CQe~~E~~  145 (151)
T PRK10778        107 EDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIR  145 (151)
T ss_pred             hCCCCceeccCCCcccHHHHhcCCCccccHHHHHHHHHH
Confidence            44567799999995221 111112357899999877543


No 67 
>PF14376 Haem_bd:  Haem-binding domain
Probab=29.05  E-value=28  Score=29.29  Aligned_cols=14  Identities=29%  Similarity=0.847  Sum_probs=11.6

Q ss_pred             CCccCCCCCCCCce
Q 023884           17 KICVDCAQKNPQWA   30 (276)
Q Consensus        17 k~C~DCga~~P~Wa   30 (276)
                      +-|.||++.+..|.
T Consensus        42 ~~CydCHSn~T~~P   55 (137)
T PF14376_consen   42 NSCYDCHSNNTRYP   55 (137)
T ss_pred             ccccccCCCCCCCc
Confidence            46999999887775


No 68 
>smart00782 PhnA_Zn_Ribbon PhnA Zinc-Ribbon. This protein family includes an uncharacterised member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterised phosphonoacetate hydrolase designated PhnA.
Probab=28.70  E-value=34  Score=23.96  Aligned_cols=34  Identities=21%  Similarity=0.563  Sum_probs=22.2

Q ss_pred             HhcCCCCCCccCCCCCCC--Cc-------eEeccccceehhhhh
Q 023884           10 LQSQPGNKICVDCAQKNP--QW-------ASVSYGVFMCLECSG   44 (276)
Q Consensus        10 L~~~p~Nk~C~DCga~~P--~W-------aS~~~GiFICl~Csg   44 (276)
                      |+++.+| +|-=|++..+  .|       .+..-.|+||..|..
T Consensus         2 L~~Rs~~-kCELC~a~~~L~vy~Vpp~~~~~~d~~iliC~tC~~   44 (47)
T smart00782        2 LLARCES-KCELCGSDSPLVVYAVPPSSDVTADNSVMLCDTCHS   44 (47)
T ss_pred             hhHHcCC-cccCcCCCCCceEEecCCCCCCCccceeeechHHHH
Confidence            3444444 4999998543  12       245678999999975


No 69 
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. VDR interacts with a VDR response element, a direct repeat of GGTTCA DNA site with 3 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation.  VDR is a member of the nuclear receptor (NR) superfamily that functions as classical endocrine receptors. VDR controls a wide range of biological activities including calcium metabolism, cell proliferation and differentiation, and immunomodulation. VDR is a high-affinity receptor for the biologically most active Vitamin D metabolite, 1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The binding of the ligand to the receptor induces a conformational change of the ligand binding domain (LBD) with consequent dissociation of core
Probab=28.61  E-value=28  Score=28.37  Aligned_cols=31  Identities=23%  Similarity=0.608  Sum_probs=25.1

Q ss_pred             CCCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           15 GNKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        15 ~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      ..+.|.-|+.+.-   ...||++.|..|.+..|-
T Consensus         5 ~~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   35 (107)
T cd06955           5 VPRICGVCGDRAT---GFHFNAMTCEGCKGFFRR   35 (107)
T ss_pred             CCCCCeecCCcCc---ccEECcceeeeecceecc
Confidence            3467999998655   459999999999998774


No 70 
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=28.37  E-value=31  Score=26.37  Aligned_cols=27  Identities=37%  Similarity=0.775  Sum_probs=21.1

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-||.+.-   ...||++.|..|....|-
T Consensus         1 C~VCg~~~~---g~hyG~~sC~aC~~FFRR   27 (81)
T cd07165           1 CKVCGDKAS---GYHYGVTSCEGCKGFFRR   27 (81)
T ss_pred             CCccCccCc---ceEECchhhhhHHHHHHh
Confidence            556776554   459999999999998874


No 71 
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=27.91  E-value=35  Score=25.44  Aligned_cols=27  Identities=37%  Similarity=0.816  Sum_probs=20.8

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-|+.+.-   ...||++.|..|....|-
T Consensus         1 C~VCg~~~~---g~hyGv~~C~aC~~FFRR   27 (73)
T cd07158           1 CKVCGDKAS---GFHYGVHSCEGCKGFFRR   27 (73)
T ss_pred             CcccCccCc---ceEECcchhhHHHHHHhh
Confidence            555776544   358999999999998874


No 72 
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=27.81  E-value=30  Score=26.73  Aligned_cols=27  Identities=37%  Similarity=0.821  Sum_probs=21.8

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-||.+.-   ...||++.|..|.+.+|-
T Consensus         2 C~VCg~~~~---g~hyGv~sC~aCk~FFRR   28 (84)
T cd06965           2 CRVCGDKAS---GFHYGVHACEGCKGFFRR   28 (84)
T ss_pred             CcccCccCc---ceEEChhhhhhhhhheee
Confidence            777887554   457999999999999874


No 73 
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=27.02  E-value=46  Score=26.04  Aligned_cols=31  Identities=29%  Similarity=0.773  Sum_probs=25.2

Q ss_pred             CCCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           15 GNKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        15 ~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      ..+.|.-|+.+.-   ...||+..|..|....|-
T Consensus         5 ~~~~C~VCg~~~~---g~hyGv~sC~aCk~FFRR   35 (90)
T cd07168           5 SPKLCSICEDKAT---GLHYGIITCEGCKGFFKR   35 (90)
T ss_pred             cCCCCcccCCcCc---ceEECceehhhhhHhhhh
Confidence            4567999998654   569999999999998864


No 74 
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers. The second DNA-binding domain (DBD) of the 2DBD nuclear receptor (NR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. The proteins contain two DBDs in tandem, probably resulting from an ancient recombination event.  The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=26.84  E-value=40  Score=25.31  Aligned_cols=27  Identities=30%  Similarity=0.765  Sum_probs=20.8

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-|+.+.-   ...||++.|..|.+..|-
T Consensus         1 C~VCg~~~~---g~hygv~sC~aC~~FFRR   27 (74)
T cd07179           1 CRVCGGKSS---GFHFGALTCEGCKGFFRR   27 (74)
T ss_pred             CcccCccCc---ceEECceeehhHHHHHHH
Confidence            556776554   458999999999998763


No 75 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=26.59  E-value=53  Score=22.02  Aligned_cols=28  Identities=29%  Similarity=0.646  Sum_probs=16.3

Q ss_pred             CCccCCCCCCCC---ceEeccccceehhhhh
Q 023884           17 KICVDCAQKNPQ---WASVSYGVFMCLECSG   44 (276)
Q Consensus        17 k~C~DCga~~P~---WaS~~~GiFICl~Csg   44 (276)
                      ++|.=||.+..+   -++-.-+++||.+|.-
T Consensus         2 ~~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~   32 (41)
T PF06689_consen    2 KRCSFCGRPESEVGRLISGPNGAYICDECVE   32 (41)
T ss_dssp             -B-TTT--BTTTSSSEEEES-SEEEEHHHHH
T ss_pred             CCccCCCCCHHHHhceecCCCCcEECHHHHH
Confidence            468889886543   3344557999999975


No 76 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=25.68  E-value=28  Score=31.60  Aligned_cols=22  Identities=32%  Similarity=0.695  Sum_probs=18.8

Q ss_pred             CCCccCCCCCCCCceEeccccceehhhhh
Q 023884           16 NKICVDCAQKNPQWASVSYGVFMCLECSG   44 (276)
Q Consensus        16 Nk~C~DCga~~P~WaS~~~GiFICl~Csg   44 (276)
                      -+.|.-||.       +.-..|.|..|..
T Consensus       309 S~~C~~cg~-------~~~r~~~C~~cg~  330 (364)
T COG0675         309 SKTCPCCGH-------LSGRLFKCPRCGF  330 (364)
T ss_pred             cccccccCC-------ccceeEECCCCCC
Confidence            479999999       6678999999965


No 77 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=25.33  E-value=64  Score=25.81  Aligned_cols=39  Identities=23%  Similarity=0.593  Sum_probs=28.5

Q ss_pred             HHHHHHHH-hcCCCCCCccCCCCCCCCceEeccccceehhhh
Q 023884            3 ATRRLRDL-QSQPGNKICVDCAQKNPQWASVSYGVFMCLECS   43 (276)
Q Consensus         3 a~~~L~~L-~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~Cs   43 (276)
                      .|+.+.+| .....--.|.-|+.....  -+..||+-|..|-
T Consensus        21 lRK~v~kie~~q~a~y~CpfCgk~~vk--R~a~GIW~C~~C~   60 (91)
T TIGR00280        21 LRRQVKKIEIQQKAKYVCPFCGKKTVK--RGSTGIWTCRKCG   60 (91)
T ss_pred             HHHHHHHHHHHHhcCccCCCCCCCceE--EEeeEEEEcCCCC
Confidence            45566665 455567799999976654  4578999999994


No 78 
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=25.10  E-value=31  Score=26.82  Aligned_cols=28  Identities=18%  Similarity=0.527  Sum_probs=22.8

Q ss_pred             CccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           18 ICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        18 ~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      .|.-|+.+.-   ...||++.|..|.+..|-
T Consensus         2 ~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   29 (86)
T cd07157           2 TCQVCGEPAA---GFHHGAYVCEACKKFFMR   29 (86)
T ss_pred             CCcccCCcCc---ccEECcceeeEeeeEEec
Confidence            4888987654   469999999999998764


No 79 
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors.
Probab=24.90  E-value=39  Score=24.89  Aligned_cols=27  Identities=26%  Similarity=0.705  Sum_probs=21.3

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-|+.+.-   ...||++.|..|.+..|-
T Consensus         2 C~vC~~~~~---~~hygv~~C~aC~~FFRR   28 (70)
T smart00399        2 CCVCGDHAS---GFHFGVCSCRACKAFFRR   28 (70)
T ss_pred             CeEeCCcCc---ccEeCCcEechhhhhhhh
Confidence            677877654   348999999999998773


No 80 
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. FXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  FXR is a member of the nuclear receptor family of ligand activated transcription factors. Bile acids are endogenous ligands for FXRs. Upon binding of a ligand, FXR binds to FXR response element (FXRE), which is an inverted repeat of TGACCT spaced by one nucleotide, either as a monomer or as a heterodimer with retinoid X receptor (RXR), to regulate the expression of various genes involved in bile acid, lipid, and glucose metabolism. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, FXR has a central well conserved 
Probab=24.20  E-value=35  Score=26.43  Aligned_cols=29  Identities=31%  Similarity=0.775  Sum_probs=23.1

Q ss_pred             CCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           17 KICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        17 k~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      ..|.-|+.+.-   ...||++.|..|.+..|-
T Consensus         2 ~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   30 (84)
T cd06962           2 ELCVVCGDKAS---GYHYNALTCEGCKGFFRR   30 (84)
T ss_pred             CCCeecCCcCc---ceEECcceeecceeeeee
Confidence            35888887655   458999999999998763


No 81 
>KOG1560 consensus Translation initiation factor 3, subunit h (eIF-3h) [Translation, ribosomal structure and biogenesis]
Probab=24.20  E-value=71  Score=30.77  Aligned_cols=25  Identities=36%  Similarity=0.652  Sum_probs=19.4

Q ss_pred             HhhhhhhhhHHHhhhhhcC-CCCCCC
Q 023884          215 SAANKEGFFSRKIAENEAR-PEGLPP  239 (276)
Q Consensus       215 ~~~~~e~yFa~~~~~Na~r-p~~lpp  239 (276)
                      ...++-.|-+++++||++| ..+.||
T Consensus       257 qq~~~~q~~aKrqaENa~R~argep~  282 (339)
T KOG1560|consen  257 QQAKKHQWIAKRQAENANRAARGEPP  282 (339)
T ss_pred             HHHHHHHHHHHHHHHhhhhhhcCCCC
Confidence            3456778999999999999 455555


No 82 
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. TR2 and TR4 interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. TR4 and TR2 are orphan nuclear receptors; the physiological ligand is as yet unidentified. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. It has been shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or
Probab=23.75  E-value=36  Score=26.47  Aligned_cols=30  Identities=30%  Similarity=0.716  Sum_probs=23.9

Q ss_pred             CCCccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           16 NKICVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        16 Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      .+.|.-|+.+.-.   ..||++.|..|.+..|-
T Consensus         3 ~~~C~VCg~~~~g---~hyGv~sC~aC~~FFRR   32 (87)
T cd06967           3 VELCVVCGDKASG---RHYGAVSCEGCKGFFKR   32 (87)
T ss_pred             CCCCeecCCcCCc---CEeCcceEeeeeeEeee
Confidence            3568999986654   58999999999998763


No 83 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=23.67  E-value=61  Score=25.86  Aligned_cols=39  Identities=21%  Similarity=0.635  Sum_probs=28.4

Q ss_pred             HHHHHHHH-hcCCCCCCccCCCCCCCCceEeccccceehhhh
Q 023884            3 ATRRLRDL-QSQPGNKICVDCAQKNPQWASVSYGVFMCLECS   43 (276)
Q Consensus         3 a~~~L~~L-~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~Cs   43 (276)
                      .|+.+.+| .....--.|.-|+......  +..||+-|..|-
T Consensus        22 lRK~v~kie~~q~a~y~CpfCgk~~vkR--~a~GIW~C~~C~   61 (90)
T PRK03976         22 IRKRVADIEEKMRAKHVCPVCGRPKVKR--VGTGIWECRKCG   61 (90)
T ss_pred             HHHHHHHHHHHHhcCccCCCCCCCceEE--EEEEEEEcCCCC
Confidence            35566665 4555677999998766654  567999999994


No 84 
>PF00105 zf-C4:  Zinc finger, C4 type (two domains);  InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain (IPR000536 from INTERPRO). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain (IPR001292 from INTERPRO). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [, ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the two C4-type zinc finger modules involved in DNA-binding. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1DSZ_A 1LO1_A 3M9E_F 2EBL_A 1GA5_B 1A6Y_B 1HLZ_B 1HRA_A 1KB6_B 1KB4_B ....
Probab=23.61  E-value=51  Score=24.06  Aligned_cols=26  Identities=31%  Similarity=0.657  Sum_probs=20.4

Q ss_pred             CCccCCCCCCCCceEeccccceehhhhhh
Q 023884           17 KICVDCAQKNPQWASVSYGVFMCLECSGK   45 (276)
Q Consensus        17 k~C~DCga~~P~WaS~~~GiFICl~Csgi   45 (276)
                      +.|.-|+.+..   ...||++.|..|...
T Consensus         1 ~~C~VCg~~~~---~~~ygv~sC~~C~~F   26 (70)
T PF00105_consen    1 KKCKVCGDPAS---GYHYGVLSCNACKMF   26 (70)
T ss_dssp             -BSTTTSSBES---EEETTEEEEHHHHHH
T ss_pred             CCCeECCCccC---cccccccccccceee
Confidence            46888997543   568999999999984


No 85 
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domains of estrogen receptor (ER) and estrogen related receptors (ERR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. ER and ERR interact with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulate the rate of transcriptional initiation. ERR and ER are closely related and share sequence similarity, target genes, co-regulators and promoters. While ER is activated by endogenous estrogen, ERR lacks the ability to bind to estrogen. Estrogen receptor mediates the biological effects of hormone estrogen by the binding of the receptor dimer to estrogen response element of target genes.  However, ERRs seem to interfere with the classic ER-mediated estrogen responsive signaling by targeting the same set of genes. E
Probab=23.43  E-value=43  Score=25.19  Aligned_cols=27  Identities=26%  Similarity=0.662  Sum_probs=20.8

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-|+.+.-   ...||++.|..|.+..|-
T Consensus         1 C~VC~~~~~---g~hygv~sC~aCk~FFRR   27 (75)
T cd07155           1 CLVCGDIAS---GYHYGVASCEACKAFFKR   27 (75)
T ss_pred             CcccCccCc---ceEEChhhhhhhHHHHHH
Confidence            556776543   468999999999998763


No 86 
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. COUP-TFs homodimerize or heterodimerize with retinoid X receptor (RXR) and a few other nuclear receptors and bind to a variety of response elements that are composed of imperfect AGGTCA direct or inverted repeats with various spacings. COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone recept
Probab=23.00  E-value=45  Score=24.90  Aligned_cols=27  Identities=33%  Similarity=0.807  Sum_probs=20.6

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-|+.+.-   ...||+..|..|.+..|-
T Consensus         1 C~VCg~~~~---g~hygv~sC~aC~~FFRR   27 (73)
T cd06958           1 CVVCGDKSS---GKHYGQFTCEGCKSFFKR   27 (73)
T ss_pred             CCccCccCc---ceEEChhhhhhhhhhhhh
Confidence            556776544   458999999999998864


No 87 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=22.88  E-value=30  Score=21.34  Aligned_cols=28  Identities=14%  Similarity=0.411  Sum_probs=16.3

Q ss_pred             CCccCCCCCCCCceEeccccceehhhhh
Q 023884           17 KICVDCAQKNPQWASVSYGVFMCLECSG   44 (276)
Q Consensus        17 k~C~DCga~~P~WaS~~~GiFICl~Csg   44 (276)
                      +.|--|+..-+.=.--....++|..|..
T Consensus         2 ~~C~rC~~~~~~~~~~~r~~~~C~rCq~   29 (30)
T PF06827_consen    2 EKCPRCWNYIEDIGINGRSTYLCPRCQK   29 (30)
T ss_dssp             SB-TTT--BBEEEEETTEEEEE-TTTCC
T ss_pred             CcCccCCCcceEeEecCCCCeECcCCcC
Confidence            3577788876554444677899998864


No 88 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=22.77  E-value=38  Score=23.27  Aligned_cols=23  Identities=39%  Similarity=0.787  Sum_probs=17.0

Q ss_pred             CccCCCCCCCCceEeccccceehhhh
Q 023884           18 ICVDCAQKNPQWASVSYGVFMCLECS   43 (276)
Q Consensus        18 ~C~DCga~~P~WaS~~~GiFICl~Cs   43 (276)
                      +|.+||......   .....-|.+|.
T Consensus         4 ~C~~Cg~~~~~~---~~~~irC~~CG   26 (44)
T smart00659        4 ICGECGRENEIK---SKDVVRCRECG   26 (44)
T ss_pred             ECCCCCCEeecC---CCCceECCCCC
Confidence            699999965433   46778899984


No 89 
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. DNA-binding domain of hepatocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. HNF4 interacts with a DNA site, composed of two direct repeats of AGTTCA with 1 bp spacer, which is upstream of target genes and modulates the rate of transcriptional initiation. HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is
Probab=22.72  E-value=44  Score=25.09  Aligned_cols=27  Identities=33%  Similarity=0.829  Sum_probs=20.9

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-||.+.-   ...||++.|..|....|-
T Consensus         1 C~vCg~~~~---~~hygv~~C~aC~~FFrR   27 (76)
T cd06960           1 CAVCGDRAT---GKHYGVLSCNGCKGFFRR   27 (76)
T ss_pred             CCccCccCc---ccEECcceeeeehheeCc
Confidence            556776544   458999999999998764


No 90 
>PF13119 DUF3973:  Domain of unknown function (DUF3973)
Probab=22.42  E-value=37  Score=23.22  Aligned_cols=13  Identities=31%  Similarity=0.887  Sum_probs=10.7

Q ss_pred             ceehhhhhhhccC
Q 023884           37 FMCLECSGKHRGL   49 (276)
Q Consensus        37 FICl~CsgiHR~L   49 (276)
                      |-|+.|+.+|-.-
T Consensus         2 yYCi~Cs~~h~e~   14 (41)
T PF13119_consen    2 YYCINCSEIHHEK   14 (41)
T ss_pred             EEEEEhHHhHHhh
Confidence            5799999999753


No 91 
>PRK05766 rps14P 30S ribosomal protein S14P; Reviewed
Probab=22.32  E-value=24  Score=25.30  Aligned_cols=38  Identities=26%  Similarity=0.741  Sum_probs=25.0

Q ss_pred             CCCCccCCCCCCCCceEeccccceehhhhhhhccCCCccccee
Q 023884           15 GNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR   57 (276)
Q Consensus        15 ~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiHR~LGvhiS~Vr   57 (276)
                      +-+.|.-||.+.  =+--.||+.||-.|-   |.+-.+|.|||
T Consensus        13 ~~nrC~~~Gr~r--gvirkf~l~lcR~~F---Re~A~~~gf~k   50 (52)
T PRK05766         13 GARECQRCGRKQ--GLIRKYGLYLCRQCF---REVAPKLGFKK   50 (52)
T ss_pred             CCceeecCCCCc--eeHHhhCCcccHHHH---HHHHHHhCcee
Confidence            456899999843  334478999999886   44444455554


No 92 
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-t
Probab=22.12  E-value=49  Score=25.06  Aligned_cols=27  Identities=30%  Similarity=0.695  Sum_probs=20.7

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-|+.+.-   ...||+..|..|.+..|-
T Consensus         1 C~VCg~~~~---g~hyG~~~C~~C~~FFRR   27 (78)
T cd07164           1 CRVCGDRAS---GKHYGVPSCDGCRGFFKR   27 (78)
T ss_pred             CcccCccCc---ceEECcchhhhhhhhhhh
Confidence            556776543   458999999999998864


No 93 
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: Ecdysone receptor (EcR), Liver X receptor (LXR) and Farnesoid X receptor (FXR). The DNA binding activity is regulated by their corresponding ligands. The ligands for EcR are ecdysteroids; LXR is regulated by oxidized cholesterol derivatives or oxysterols; and bile acids control FXR's activities. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcR-like receptors have  a central well conserved DNA binding domai
Probab=21.85  E-value=56  Score=24.41  Aligned_cols=27  Identities=41%  Similarity=0.904  Sum_probs=21.4

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-|+.+.-   ...||+..|..|.+..|-
T Consensus         2 C~vCg~~~~---~~hygv~sC~aC~~FFRR   28 (73)
T cd06959           2 CVVCGDKAS---GFHYGVLSCEGCKGFFRR   28 (73)
T ss_pred             CceeCCcCc---ceEECceeehhhHHHHHH
Confidence            667776554   468999999999998874


No 94 
>PHA02942 putative transposase; Provisional
Probab=21.76  E-value=41  Score=33.03  Aligned_cols=26  Identities=23%  Similarity=0.553  Sum_probs=19.8

Q ss_pred             CCCccCCCCCCCCceEeccccceehhhhh
Q 023884           16 NKICVDCAQKNPQWASVSYGVFMCLECSG   44 (276)
Q Consensus        16 Nk~C~DCga~~P~WaS~~~GiFICl~Csg   44 (276)
                      -+.|..||...+   .++-.+|.|..|--
T Consensus       325 Sq~Cs~CG~~~~---~l~~r~f~C~~CG~  350 (383)
T PHA02942        325 SVSCPKCGHKMV---EIAHRYFHCPSCGY  350 (383)
T ss_pred             CccCCCCCCccC---cCCCCEEECCCCCC
Confidence            468999998765   34556899999954


No 95 
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family of NRs includes four types of nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). The receptors bind to common DNA elements containing a partial palindrome of the core sequence 5'-TGTTCT-3' with a 3bp spacer. These four receptors regulate some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family have high sequence homology and sha
Probab=21.73  E-value=56  Score=24.50  Aligned_cols=27  Identities=26%  Similarity=0.704  Sum_probs=20.6

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-|+.+.-   ...||++.|..|.+..|-
T Consensus         1 C~VCg~~a~---~~hygv~sC~aCk~FFRR   27 (73)
T cd06963           1 CLICGDEAS---GCHYGVLTCGSCKVFFKR   27 (73)
T ss_pred             CcccCccCc---ceEECceeehhhhHhHHH
Confidence            555776443   568999999999998864


No 96 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=21.71  E-value=28  Score=28.36  Aligned_cols=33  Identities=24%  Similarity=0.460  Sum_probs=23.1

Q ss_pred             hcCCCCCCccCCCCCCCCceEeccccceehhhhhhh
Q 023884           11 QSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKH   46 (276)
Q Consensus        11 ~~~p~Nk~C~DCga~~P~WaS~~~GiFICl~CsgiH   46 (276)
                      ...|..-+|-+||..   +....+..|.|..|-+..
T Consensus        65 ~~~p~~~~C~~Cg~~---~~~~~~~~~~CP~Cgs~~   97 (114)
T PRK03681         65 EEQEAECWCETCQQY---VTLLTQRVRRCPQCHGDM   97 (114)
T ss_pred             EeeCcEEEcccCCCe---eecCCccCCcCcCcCCCC
Confidence            456777899999963   333345568899998654


No 97 
>KOG1597 consensus Transcription initiation factor TFIIB [Transcription]
Probab=21.01  E-value=61  Score=31.21  Aligned_cols=28  Identities=29%  Similarity=0.502  Sum_probs=22.3

Q ss_pred             CCccCCCCCCC-CceEeccccceehhhhh
Q 023884           17 KICVDCAQKNP-QWASVSYGVFMCLECSG   44 (276)
Q Consensus        17 k~C~DCga~~P-~WaS~~~GiFICl~Csg   44 (276)
                      ..|.||..+-+ .-.+..-|..+|.+|--
T Consensus         1 ~~c~~C~~~~~~~V~d~~~gdtvC~~CGl   29 (308)
T KOG1597|consen    1 MTCPDCKRHPENLVEDHSAGDTVCSECGL   29 (308)
T ss_pred             CCCCCCCCCCCCeeeeccCCceecccCCe
Confidence            36999999766 55566789999999954


No 98 
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TR interacts with the thyroid response element, which is a DNA site with direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pairs, upstream of target genes and modulates the rate of transcriptional initiation. Thyroid hormone receptor (TR) mediates the actions of thyroid hormones, which play critical roles in growth, development, and homeostasis in mammals. They regulate overall metabolic rate, cholesterol and triglyceride levels, and heart rate, and affect mood. TRs are expressed from two separate genes (alpha and beta) in human and each gene generates two isoforms of the receptor through differential promoter usage or splicing. TRalpha functions in the he
Probab=20.36  E-value=50  Score=25.55  Aligned_cols=27  Identities=33%  Similarity=0.748  Sum_probs=21.4

Q ss_pred             ccCCCCCCCCceEeccccceehhhhhhhcc
Q 023884           19 CVDCAQKNPQWASVSYGVFMCLECSGKHRG   48 (276)
Q Consensus        19 C~DCga~~P~WaS~~~GiFICl~CsgiHR~   48 (276)
                      |.-|+.+.-   ...||++.|..|.+..|-
T Consensus         2 C~VCg~~~~---g~hygv~sC~aC~~FFRR   28 (85)
T cd06961           2 CVVCGDKAT---GYHYRCITCEGCKGFFRR   28 (85)
T ss_pred             CceeCCcCc---ceEEChhhhhhhhHhhHh
Confidence            677887544   458999999999998873


No 99 
>PHA02540 61 DNA primase; Provisional
Probab=20.17  E-value=62  Score=31.54  Aligned_cols=58  Identities=24%  Similarity=0.492  Sum_probs=41.2

Q ss_pred             CCCCccCCCCCCC------CceEeccc--cceehhhhhhhccCCCcccceeecccCCCCHHHHHHHHhcC
Q 023884           15 GNKICVDCAQKNP------QWASVSYG--VFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGG   76 (276)
Q Consensus        15 ~Nk~C~DCga~~P------~WaS~~~G--iFICl~CsgiHR~LGvhiS~VrSvtmD~Ws~~el~~m~~gG   76 (276)
                      -|-.|-=|+...+      =|++..-+  +|-|-.| |.|   |--|.||....-..|.+.-.++.+..|
T Consensus        26 ~~~~CPf~~ds~~~~~kpsF~V~p~k~~~~yhCFgC-Ga~---Gd~i~Flme~e~lsf~Eav~~la~~~g   91 (337)
T PHA02540         26 YNFRCPICGDSQKDKNKARGWIYEKKDGGVFKCHNC-GYH---RPFGNFLKDYEPDLYREYIMERFKERG   91 (337)
T ss_pred             EEecCCCCCCccccCcCCcEEEeccCCceEEEecCC-CCC---CCHHHHHHHhcCCChHHHHHHHHHHhC
Confidence            3778999998554      48888888  9999999 555   345777777776677664444444445


Done!