BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023897
(275 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4A18|X Chain X, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 26s Rrna And
Proteins Of Molecule 1
pdb|4A1B|X Chain X, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 26s Rrna And
Proteins Of Molecule 3.
pdb|4A1D|X Chain X, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 26s Rrna And
Proteins Of Molecule 4.
pdb|4A19|X Chain X, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 26s Rrna And
Proteins Of Molecule 2
Length = 189
Score = 29.6 bits (65), Expect = 2.0, Method: Compositional matrix adjust.
Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 9/71 (12%)
Query: 147 KVRIRDEATCSSFLRIFESEGCKMLEMSCEEHDKVAAKSQF---------LTHTIGRVLS 197
++++R ++ L I + ++L+M D+V AK++F + + GR+LS
Sbjct: 15 QMKVRQYVVSAARLPIEQGTKPEILQMRVFARDEVHAKTKFWYNMRKLNKIKRSQGRILS 74
Query: 198 ELEIQSTSMNT 208
EI S+NT
Sbjct: 75 VNEIYEKSLNT 85
>pdb|1Z5X|U Chain U, Hemipteran Ecdysone Receptor Ligand-Binding Domain
Complexed With Ponasterone A
Length = 262
Score = 27.3 bits (59), Expect = 9.2, Method: Compositional matrix adjust.
Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
Query: 221 SVNDSFDLFSGLYIHNRFAKQELLDLEAAFEKVKHKLQQKMEEVQLEQS 269
SV D L +GL +H A Q + A F++V +L KM E++++++
Sbjct: 120 SVKDGIMLATGLVVHRNCAHQA--GVGAIFDRVLTELVAKMREMKMDKT 166
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.131 0.368
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,515,350
Number of Sequences: 62578
Number of extensions: 228395
Number of successful extensions: 507
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 507
Number of HSP's gapped (non-prelim): 4
length of query: 275
length of database: 14,973,337
effective HSP length: 97
effective length of query: 178
effective length of database: 8,903,271
effective search space: 1584782238
effective search space used: 1584782238
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)