Citrus Sinensis ID: 023905

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----

MPISSLSPIGHCPPSLSLKCNFPFRPTRKASILASPKQPLIFTTKRTTTHIVSMSYEAGIGVMGTKLGMMSYFEPDGTVVPVTVVGFREGNIVTQVKTEATDGYDAVQIGYRRVRDKKLTKPELGHLQKSGLIPMRHLQEFRLQSIDGFEAGQKLAFEEIFNEGDLVDVSGTTIGKGFQGGIKRHNFRRGAMTHGSKSHRQLGSIGAGTTPGRVYKGKKMPGRMGGTTRKIRKLKIVKIDNDLRVVMIKGAVPGKPGNLLRVAPAKIVGKNIPKN

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccEEEEcccccEEEEEEEEEccccEEEEEEccccccccEEEEEcccccccccccccccHHHHcccccccEEEEEEcccccccccccEEEcccccccccEEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccEEEEEEccccEEEEEcccccccccEEEEEEccccccccccc

****************SLKCNFPFRPTRKASILASPKQPLIFTTKRTTTHIVSMSYEAGIGVMGTKLGMMSYFEPDGTVVPVTVVGFREGNIVTQVKTEATDGYDAVQIGYRRVRDKKLTKPELGHLQKSGLIPMRHLQEFRLQSIDGFEAGQKLAFEEIFNEGDLVDVSGTTIGKGFQGGIKRHNFR**************GSIGAGTTPGRVYKGKKMPGRMGGTTRKIRKLKIVKIDNDLRVVMIKGAVPGKPGNLLRVAPAKIV*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L3-1, chloroplastic	One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.	confident	Q9SKX4
50S ribosomal protein L3, chloroplastic (Fragment)	One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.	probable	O80360
50S ribosomal protein L3	One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.	probable	Q2JIM7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain F
Confidence level:very confident
Coverage over the Query: 115-268
View the alignment between query and template
View the model in PyMOL